KEGG   Anolis carolinensis (green anole): 100559043Help
Entry
100559043         CDS       T01608                                 

Definition
dihydrofolate reductase-like
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
acs  Anolis carolinensis (green anole)
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:acs00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:acs00670]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
2
AA seq 187 aa AA seqDB search
MVLSLNSIAAVCQNMGIGKNGQLPWPPLRNEFKYFQKMTMTPTQEGKQNVVIMGKRTWFS
IPEKNRPLKDRINIILSREMKEVPKGAHYLARSLDEALDLLQSPELENKIDLVWIVGGSS
VYKAAMDKPIHHRLFVTRILHDFESDTFFPEIDLEKYKLIPSYAGVPTDIQEENGIRYRF
EVYEKNI
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atggtgctctctttgaactccatcgccgccgtgtgtcaaaacatgggcatcgggaagaac
ggacaacttccttggcccccactcaggaatgagtttaagtactttcagaaaatgactatg
acacctacacaagaaggaaaacagaatgtagtaataatggggaagaggacttggttctcc
attcctgaaaaaaatcgccctttaaaagacagaatcaatattatactcagcagggaaatg
aaggaagttccaaaaggagcccattacctagctagaagtctagatgaggcactagatctc
ctacaatcgccagaattggaaaataaaatagacttggtttggatagttggaggcagttca
gtttataaggcagcaatggacaagccaattcatcatcgactctttgttacaagaatctta
catgactttgaaagtgatacattttttccagaaattgatttagaaaaatataagctgata
cctagctatgcaggggtccccactgatattcaggaggagaatggcattcgctacagattt
gaagtttatgaaaagaacatctag

DBGET integrated database retrieval system