KEGG   Anolis carolinensis (green anole): 100559107Help
Entry
100559107         CDS       T01608                                 

Definition
GPI-linked NAD(P)(+)--arginine ADP-ribosyltransferase 1-like
Orthology
K06716  
ADP-ribosyltransferase 1 [EC:2.4.2.31]
Organism
acs  Anolis carolinensis (green anole)
Brite
Enzymes [BR:acs01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     100559107
Cellular antigens [BR:acs04090]
 Proteins
  100559107
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 318 aa AA seqDB search
MERPLFQMLLAMHLLWIFPGDIQVSGFPIHRRDLFPAKESPLDLASTSFDDQYKGCAEQM
EAELEALNQTEFATNRLYAEAWTEAASRWTERRMSTSKLPLGLRPEHAMAVMAYTAQGRF
HRDFNAAVREAGRTREAYLQGFHFKTFHFLLTRALQALGATSQPRCQKVYRGVRNVRFVS
ERLRPVRFGHFASSSLKNESAKQFGTDTFFTIHTCFGVNVQNFSFFPGEEEVLIPPFEKF
KVANFTKTRETTFIHLLSLEDHSLHNCVFIKEQRCKVQRCNFGSGAGLSQLSAHAQAPFL
LWGALFLVGILFESPGFL
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atggagaggcctcttttccagatgttgctggcgatgcatctgttgtggatcttcccagga
gacatccaggtctccggcttccccatccacaggcgtgacctcttccccgccaaggagtcc
cctctggacctggcgtccacttccttcgatgaccaatacaagggctgcgcggagcagatg
gaggccgagctggaggccctcaaccagacagagtttgccaccaaccggctctacgccgag
gcctggacggaagcggcttccaggtggacagagcgacggatgtccacctcaaagctgccc
ctcggcctgaggccagagcacgccatggcggtcatggcctacacggcgcaaggacgcttc
caccgggacttcaacgcggccgtcagggaggccggacggaccagggaggcctacctgcag
ggcttccacttcaagaccttccacttcctcctgacccgggccctgcaggccttgggggcc
acttcccagccccgctgccagaaggtctaccgcggggtccgcaacgtccgcttcgtctcc
gagcggctccgtccggtgcgctttggccacttcgcctcctcctcgctcaagaacgagagc
gccaaacagttcgggacggacaccttcttcaccatccacacctgctttggggtcaacgtc
cagaacttctccttcttccccggagaagaggaggtcctcatcccgcccttcgagaagttc
aaggtggccaacttcaccaagacacgtgagaccaccttcatccacctgctctccctcgaa
gaccacagcctccacaactgcgtcttcatcaaagagcaaaggtgcaaagtgcaaaggtgc
aactttggttcaggtgccggcctcagccagctctctgcacatgcccaggcgcctttcctt
ctctggggagccctgttccttgtgggcatcctctttgagtccccaggattcctctga

DBGET integrated database retrieval system