KEGG   Anolis carolinensis (green anole): 100559138Help
Entry
100559138         CDS       T01608                                 

Gene name
prkacb
Definition
protein kinase, cAMP-dependent, catalytic, beta
Orthology
K04345  
protein kinase A [EC:2.7.11.11]
Organism
acs  Anolis carolinensis (green anole)
Pathway
MAPK signaling pathway
Calcium signaling pathway
Oocyte meiosis
Apoptosis
Adrenergic signaling in cardiomyocytes
Vascular smooth muscle contraction
Wnt signaling pathway
Hedgehog signaling pathway
Gap junction
Insulin signaling pathway
GnRH signaling pathway
Progesterone-mediated oocyte maturation
Melanogenesis
Module
cAMP signaling
Brite
KEGG Orthology (KO) [BR:acs00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100559138 (prkacb)
   04310 Wnt signaling pathway
    100559138 (prkacb)
   04340 Hedgehog signaling pathway
    100559138 (prkacb)
   04020 Calcium signaling pathway
    100559138 (prkacb)
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    100559138 (prkacb)
   04210 Apoptosis
    100559138 (prkacb)
  Cellular commiunity
   04540 Gap junction
    100559138 (prkacb)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    100559138 (prkacb)
   04912 GnRH signaling pathway
    100559138 (prkacb)
   04914 Progesterone-mediated oocyte maturation
    100559138 (prkacb)
   04916 Melanogenesis
    100559138 (prkacb)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100559138 (prkacb)
   04270 Vascular smooth muscle contraction
    100559138 (prkacb)
Enzymes [BR:acs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     100559138 (prkacb)
Protein kinases [BR:acs01001]
 Serine/threonine protein kinases: AGC group
  PKA family
   100559138 (prkacb)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 398 aa AA seqDB search
MAAQKELQGNPSTGTANALQRLEGFANRLFHRHSKGSSSELKAAQENESPHFSELAALWE
RSMKEFLAKAKEDFLRKWESPPQNTAGLEDFERLKTLGTGSFGRVMLVKHKATEQYYAMK
ILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVRLEYSFKDNSNLYMVMEYVPGGEMFSHL
RRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVK
GRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVS
GKVRFPSHFSSDLKDLLRNLLQVDLTKRYGNLKNGVNDIKNHKWFATTDWIAIYQRKVEA
PFIPKCRGPGDTSNFDDYEEEDIRVSLTEKCAKEFADF
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atggctgctcagaaggagttacagggcaacccaagcacagggactgcaaatgctttgcag
agactggagggatttgccaacaggctttttcacaggcactccaagggctcctccagtgaa
ctgaaagcagctcaggaaaatgagtctccgcacttctctgaacttgctgcactgtgggag
agatcaatgaaagagttcctagccaaagccaaagaagattttttaagaaaatgggaaagc
ccccctcagaatactgctggtttagaagactttgagaggctaaaaacacttggaactggg
tcatttggcagagttatgttggtgaagcataaagcaacagaacagtattatgccatgaag
atactggataaacaaaaagtggttaaactgaagcaaatagaacacacactgaatgaaaaa
agaatattacaagcagtgaactttccttttcttgtaagactggagtattcttttaaggac
aattctaatttatacatggttatggaatatgttcctgggggtgaaatgttctcacattta
agaagaattgggaggttcagtgaaccacatgcaagattttatgcagcccagatagtgcta
acttttgagtacctccactcactagacctcatttacagagatctaaaacccgaaaacctt
ttaattgaccaacaaggatatatccaggtcacagacttcgggtttgcaaaaagagtaaaa
gggaggacctggacgttatgtgggactccagaatatttggctcctgaaataattctcagc
aagggctacaacaaagcagtagattggtgggccttaggagtgctaatttatgaaatggca
gctggatatccaccattctttgcagatcagccaatccagatatatgaaaaaattgtttct
ggaaaggtacggttcccatcgcacttcagttcagatcttaaagatctactaagaaattta
ctccaagtagatttgaccaaacgatatggcaatctcaagaacggagtgaatgatattaaa
aatcacaaatggtttgccactacagattggattgccatttatcagagaaaggtagaagcc
cccttcataccaaaatgtagaggtcctggagataccagcaattttgatgactatgaggaa
gaagatatccgcgtgtctctaacagaaaaatgtgcaaaggaatttgctgatttttag

DBGET integrated database retrieval system