KEGG   Anolis carolinensis (green anole): 100559347Help
Entry
100559347         CDS       T01608                                 

Gene name
plcg1
Definition
(RefSeq) phospholipase C gamma 1
  KO
K01116  phosphatidylinositol phospholipase C, gamma-1 [EC:3.1.4.11]
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs00562  Inositol phosphate metabolism
acs01100  Metabolic pathways
acs04012  ErbB signaling pathway
acs04020  Calcium signaling pathway
acs04070  Phosphatidylinositol signaling system
acs04370  VEGF signaling pathway
acs04933  AGE-RAGE signaling pathway in diabetic complications
Module
acs_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:acs00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100559347 (plcg1)
 Environmental Information Processing
  Signal transduction
   04012 ErbB signaling pathway
    100559347 (plcg1)
   04370 VEGF signaling pathway
    100559347 (plcg1)
   04020 Calcium signaling pathway
    100559347 (plcg1)
   04070 Phosphatidylinositol signaling system
    100559347 (plcg1)
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    100559347 (plcg1)
Enzymes [BR:acs01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     100559347 (plcg1)
Membrane trafficking [BR:acs04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    100559347 (plcg1)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    100559347 (plcg1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI-PLC-X SH2 PI-PLC-Y SH3_1 C2 PH SH3_9 SH3_2 GDPD PH_12
Motif
Other DBs
NCBI-GeneID: 100559347
NCBI-ProteinID: XP_003225342
Ensembl: ENSACAG00000011128
UniProt: H9GHK8
Position
Un
AA seq 1283 aa AA seqDB search
MASLFTNGPCIQSEAEVVHLYRSLEVGTVMTLFYSKKSQRPERKTFQVKLETRQVIWSRG
SEKIEGAIDIREIQEIRLGRNSRDFDRYQEDPSFRPDPAHCFVILYGMEFRLKTLSLQAT
SEDEVSMWIKGLNWLVADTLKAATPLQIERWLRKQFYSIDRNREDRISAKDLKNMLSQVN
YRVPNMRFLRERLTDVEQRNGDITYGQFAQLYQSLMYDAQKGMVVPFLESSGERSEHSRV
SLTEFRTFLLDYQMELWATNLSLVQDFMFNFLKDPLREIEEPYFSLDEFLTFLFSKENSI
WNSELNVVRPEDMNNPLSHYWISSSHNTYLTGDQFSSESSLEAYARCLRMGCRCIELDCW
DGPDGMPVIYHGHTLTTKIKFSDVLATIKEHAFVTSEYPVILSIEDHCSIAQQRNMAQNF
KKVFGDMLLTKPVDISADGLPSPNQLKRKILIKHKKLAEGSAYEEVPSSAVYSENDISNS
IKNGILYLEDPINHDWNPHYFVLTSSKIYYSEETTNDLGNEEEEEQKEVNNSTELHSTEK
WFHGKLGAGRDGRHIAERLLTEYCIETGAPDGSFLVRESETFVGDYTLSFWRNGKVQHCR
IHSRQDAGSPKFFLTDNLVFNSLYDLITHYQQVPLRCNEFEMRLTEPVPQTNAHESKEWY
HANLTRTLAERMLMRVPRDGAFLVRKRSEQNSYAISFRAEGKIKHCRVQQDGQTVMLGNS
EFDSLVDLISYYEKHPLYRKMKLRYPINEETLEKIGTAEPDYGALYEGRNPGFYVEANPM
PTFKCAVKALFDYKAQREDELTFTKNAVIQNVEKQEGGWWRGDYGGKKQLWFPSNYVEEI
TSPTGLEPEREQQLDENSPLGDMLGGVLEVPACQIAIRPEGKNNRMFVFSISMASGPRLS
LDVAANSHEELLDWVKKIREAAQTADARLSEGKMMERRKKIALELSELVIYCRPVPFDEE
KIGTDRACYRDMSSFPETKAEKYVNKIKGKRFLQYNRLQLSRIYPKGQRLDSSNYDPLPM
WICGSQLVALNFQTPDKPMQMNQALFMSGGRCGFVLQPGNMRDDIFDPFDKNTLRGMEPL
SVSIEVLGARHLPKNGRGIVCPFVEVEIAGTEYDNAKQKTEMVVDNGLNPAWPQKSFQFH
IHNPEFAFLRFVVYEEDMFSDQNFLAQATFLVKGLKTGYRSVPLKNNYSEDLELASLLVK
IDIIPGKLENGDVSPFGASAFRERSMDSPGQLMAGRGREGSFETRYQQPFEDFRLSQEQL
ADHFDNRDRRALRKTRVNGDNRL
NT seq 3852 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcgcttttcaccaacggaccctgcatccaaagcgaagccgaggtggtccatctc
taccggagcctggaagtgggcaccgtgatgacgctcttctactccaagaagtcccaaagg
cccgagaggaagaccttccaggtgaagctggagacccggcaggtcatttggagccggggc
tcggagaaaatcgaaggcgcaattgatattcgtgaaatccaggagattcgtctgggaaga
aactcccgtgattttgaccgctatcaggaggatccttctttccgtccagatccggctcat
tgttttgtcatcctttatggcatggaattcagattgaaaacactgagccttcaagccaca
tccgaagatgaagtcagcatgtggatcaaagggctgaactggcttgtagcggatacccta
aaagctgctaccccgttgcagattgaaaggtggcttcgaaaacagttttactccatagat
cgcaacagggaagacaggatttctgcaaaggatctgaaaaacatgctgtcacaagtcaac
taccgtgtccctaatatgaggtttttacgtgaaaggttaacagatgtggagcaaaggaat
ggggatatcacatatgggcagtttgcccagttgtaccagagcctcatgtacgatgcacag
aaagggatggttgttccattcttagaaagcagtggagagagatctgaacatagcagagta
tccctgacagaattccggacatttttgctagattatcaaatggaactctgggctactaac
ctttctttggttcaagatttcatgttcaacttcctgaaggaccccttgagggaaattgaa
gagccttatttttccctggatgagtttctcacttttctgttttccaaagagaatagtatc
tggaactcagagcttaatgttgtgcgtccagaggatatgaacaaccccctctcccactac
tggatttcctcttctcataatacgtaccttactggagatcagttctcaagtgagtcctca
ttggaagcttatgctcgttgcttgcgcatgggatgccgctgtattgagcttgattgctgg
gatggacctgatgggatgccagtcatttatcatgggcacacattaacaaccaaaatcaag
ttttccgatgttctggctaccatcaaggaacatgcctttgtaacctctgaataccctgtt
atcctgtccattgaagatcactgcagcattgcacagcagaggaatatggctcaaaacttt
aagaaggtctttggagacatgctactaaccaagccagtcgatatatctgctgatgggtta
ccatctccaaatcagctaaagaggaagattcttataaagcacaagaaattggctgaaggc
agtgcttacgaagaagtgccatcatccgctgtgtattcagagaatgatatcagcaactca
ataaagaatggaattctttacctggaagatccaatcaatcacgactggaacccccattac
tttgtcctcaccagcagcaaaatatattattctgaagagacaaccaatgatttgggaaat
gaggaggaagaagaacaaaaggaggttaacaacagcactgaactgcattctactgagaaa
tggttccatggcaaactaggagcaggacgtgatgggcgccatatagccgaaaggctgtta
acagagtactgcatagaaacaggagcacctgatggttctttcttggtgcgagagagtgag
acctttgtgggcgattacacactttctttttggcgcaatgggaaagtacagcactgccgg
atccattcacgacaggatgccgggagccccaaattctttctcacggataacctggtgttc
aatagcctgtatgaccttatcacacattaccagcaggtgcctcttaggtgcaatgaattt
gagatgaggctgactgagcctgtgcctcagaccaacgctcacgagagcaaggaatggtac
catgctaatcttacccggactttggcagagcgcatgctgatgcgggtgcctcgggatgga
gcattcctggtgcgcaagaggagtgaacagaactcctatgcgatttcctttcgggcagaa
gggaagatcaaacactgtcgtgtacaacaggatggacaaacagtcatgttgggcaactca
gaatttgatagcctggtagatttaataagctactatgaaaagcatccactgtaccgcaaa
atgaagcttaggtatcccattaatgaagaaactctagagaagatcggaacagcggaacca
gattatggcgctctctatgaaggacggaacccaggcttttatgtggaagctaatcctatg
ccaaccttcaagtgtgctgtcaaagccttattcgactacaaggctcaacgagaggatgag
ctcaccttcaccaaaaatgctgtgatacagaatgtagaaaaacaggagggaggctggtgg
agaggagactatgggggcaagaagcagctctggtttccatctaactacgtagaagaaata
actagcccaactggcctggagccggagagggagcaacagctagatgaaaacagtcccctg
ggagacatgcttggtggagtccttgaagtaccagcctgccagattgctatccgtcctgaa
ggcaagaacaaccgcatgtttgtgttctctatcagtatggcttctggaccacggttgtcc
ctagatgtggctgctaactcacatgaggagttgttggattgggtgaagaagattcgagag
gcagctcaaactgctgatgctagactctctgaagggaagatgatggagaggaggaagaaa
atagctctagaactttctgaactagtcatttactgccgtcctgtcccctttgatgaagag
aaaattggcacagacagggcttgttacagggacatgtcctccttccctgaaaccaaggca
gaaaagtatgtcaacaagatcaaaggcaagagatttctgcagtacaaccggttacagctt
tcccgcatctatccaaaaggacagcgtcttgactcctccaactatgacccccttccaatg
tggatctgtggcagccagttggtggcgctcaactttcagacaccagacaagccaatgcag
atgaatcaggctttgttcatgtctggaggccgatgtggctttgtgttgcaaccaggcaac
atgcgggatgacatctttgatccctttgacaagaacactctgcggggaatggagccgctt
tctgtttccattgaggtcctcggggctcggcatctgcccaaaaatggaagaggaattgtt
tgtccatttgtagaggttgagattgctggaacagagtatgataacgcaaagcagaagact
gagatggtggtggataatggcctgaaccctgcctggccccagaaatcgtttcagttccat
attcacaacccagaatttgcctttttgcgcttcgtggtatatgaagaagatatgttcagt
gaccagaatttcttagctcaggctacattcctggttaaaggcctaaagacaggataccgt
tctgtgcctttgaagaacaattacagtgaggacctggagctggcttctttgctggttaaa
attgatataatccctggaaaactggagaatggtgacgttagcccctttggggcttcagct
ttccgagagaggtccatggattctccaggtcagctcatggccggacgaggcagagaaggc
tcctttgagacccgatatcagcagccatttgaagactttcgattatcccaggagcagtta
gcagaccactttgacaatcgagacagaagggcactgcgaaagacccgggtgaatggagat
aaccgcctctag

DBGET integrated database retrieval system