KEGG   Anolis carolinensis (green anole): 100559362Help
Entry
100559362         CDS       T01608                                 

Gene name
eif3j
Definition
eukaryotic translation initiation factor 3, subunit J
Orthology
K03245  
translation initiation factor 3 subunit J
Organism
acs  Anolis carolinensis (green anole)
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:acs00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    100559362 (eif3j)
Translation factors [BR:acs03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    100559362 (eif3j)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 261 aa AA seqDB search
MAAVADSWDADTFGAAAEAEEAGRHQARLPTPSVAAAADRWAGEDEDDDVKDNWDDEEEE
EEKEKEVEVKTEPKVSEKKKIAEKIKEREKQQKKKQEEIKKRLEASEESTELTPEEQLAD
KLRLQKLQEEADLELAKETFGVNSTCGIDAMNPSSKDDFTEFGKLLKEKITQYEKSLYYP
GFLETLVRDICISLEVDDLKKVTNSLTVLCSEKQKQEKQNKAKKKKKGVVPGGGLKATMK
DDLADYGGYDGGYVQDFEDFM
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggtggcggattcctgggacgcggacaccttcggggcggcggccgaggcggag
gaggccggaaggcaccaggcccggttgcccacgccctcggtggcggcagcggcggaccgg
tgggccggagaggacgaggacgacgacgtcaaggataactgggacgatgaggaggaggaa
gaggagaaggaaaaggaggtggaggtgaagacagaacccaaagtgtcagaaaagaagaaa
atagcagaaaaaattaaagagagggaaaaacagcagaagaaaaagcaagaggagattaaa
aaaaggctagaggcatcggaagaatcaacagaacttacaccagaagaacagctagcagat
aaactacggcttcagaagttgcaagaagaggcagacctggagctagcaaaagaaaccttt
ggtgtaaatagcacatgtggaatagatgccatgaacccctcttcgaaagatgactttacg
gaattcggcaaactattaaaagaaaaaataacacagtacgagaaatccctatattaccct
ggttttttggaaacgctagttcgagatatatgcatttcattggaagtcgatgacttgaaa
aaggtcacaaattccttgactgtgctatgcagcgagaagcaaaaacaagaaaagcaaaac
aaggccaagaagaagaagaaaggggtggtgccgggcggaggcctgaaggccaccatgaag
gacgacctggcggactacggaggctacgatggcggctacgtccaggacttcgaagacttc
atgtga

DBGET integrated database retrieval system