KEGG   Anolis carolinensis (green anole): 100559376Help
Entry
100559376         CDS       T01608                                 

Gene name
ptpn5
Definition
protein tyrosine phosphatase, non-receptor type 5 (striatum-enriched)
Orthology
K18018  
tyrosine-protein phosphatase non-receptor type 5 [EC:3.1.3.48]
Organism
acs  Anolis carolinensis (green anole)
Pathway
MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:acs00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100559376 (ptpn5)
Enzymes [BR:acs01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     100559376 (ptpn5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
1
AA seq 526 aa AA seqDB search
MEPLNDADGEQDQLSKAEEPHKCTGGTLQQSWVAWWNGLTTGGIVYLFALSQILVFFFMF
WCGGSETIPTLVNALDVFPNLLIPFGQLVIDSTKDLIRNGGLTMSYFLLSLISFGLLLIG
ILVWYLVNPPPDPPFPLQEDRRQSVSRQPSFTYSEWTEDKNEDDFLDLDPVPETPVFDCV
MDMKVETDPITLTVKSVGLQERRGSNVSLTLDMCTPGCTEQGFGYVMSPREESAREYLQT
ASNVLTEEELHEKALDSFVLQTEFFEIPMNFIDPKEYDIPGLVRKNRYKTILPNSHSRVC
LTSDDQDDPLSSYINANYIRGYGGEEKVYIATQGPIVNTVSDFWRMVWQEHSPIIVMITN
IEEMNEKCTEYWPEEQVTYEGIEITVNQVIQADDYRLRLITLKKDEETRVLKHFWYTSWP
DQKTPDQAPPLLQLVQEVEEAMQCTEAKSGPIIVHCSAGIGRTGCFIATSICCKQWKNEG
VVDILRTTCQLRLDRGGMIQTSEQYQFVHHVMSLYEKQFSRAAAEE
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atggaaccattgaatgatgctgatggagagcaggatcaactcagcaaggcagaagaaccc
cataaatgcactggggggactttacagcagagctgggtggcctggtggaatggactcacc
acaggaggaatcgtgtatctgtttgccttatcacagatattggttttcttctttatgttt
tggtgcggtggctctgagactatcccaacacttgtaaatgctttggatgtgttccccaac
ctgctcattccatttggacaattggttatagattctaccaaggatctgatccgaaatgga
ggcctcacaatgtcctacttcctgctatctttgatttcctttggtttgctgctcatagga
atattggtctggtatcttgtgaatccacctccagatcccccatttccccttcaagaggac
agacggcaatcggtaagccgccagccttcattcacatactctgaatggacagaggacaaa
aacgaggatgatttccttgatctggacccagtgccagagacacccgtttttgactgtgtg
atggacatgaaagtggagacagatccaataaccctaactgttaaatccgtgggactgcaa
gaaaggaggggctccaatgtttcactcacactggacatgtgcactccagggtgcactgag
caaggctttggctatgtcatgtctccaagggaggagtcagctcgagaatacctccagaca
gcatcaaatgttctcactgaggaagaattacacgagaaagcattagattcttttgtactc
cagacagagttttttgaaattccaatgaattttattgatccaaaggaatatgatattcct
ggtttggtccgaaagaatcgctacaaaacaattctcccaaattctcacagcagagtgtgc
cttacctcagatgatcaagatgatcccctgagctcttacatcaatgccaactacatcagg
ggctatggaggagaagagaaggtgtacattgctactcagggacccatagttaatactgtc
agtgatttctggaggatggtatggcaggagcattctccaattattgtcatgattaccaat
attgaagagatgaatgagaaatgtaccgaatactggccagaagagcaggttacatatgaa
ggaattgaaatcacggttaaccaagtcatacaagcagatgattatcggttaaggcttatt
accctcaagaaagatgaagaaacaagagttttgaagcacttctggtatacgtcatggcca
gaccagaagacgcctgatcaggcacctcccctgttgcagctggttcaggaggtggaagag
gccatgcaatgcacagaagcgaagagtggtcctatcatagttcactgcagtgctgggatt
gggaggactggttgtttcattgccaccagcatttgctgcaaacagtggaagaacgaaggt
gtggttgacatactcagaacaacctgccaactacggctagacagaggtggaatgatccaa
acttctgaacagtatcagttcgtccaccatgtcatgagcttgtatgaaaagcagttttcg
agagcagcagctgaagaataa

DBGET integrated database retrieval system