KEGG   Anolis carolinensis (green anole): 100559401Help
Entry
100559401         CDS       T01608                                 

Gene name
plcd3
Definition
(RefSeq) phospholipase C, delta 3
  KO
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
acs  Anolis carolinensis (green anole)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Calcium signaling pathway
Phosphatidylinositol signaling system
AGE-RAGE signaling pathway in diabetic complications
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:acs00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100559401 (plcd3)
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    100559401 (plcd3)
   04070 Phosphatidylinositol signaling system
    100559401 (plcd3)
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    100559401 (plcd3)
Enzymes [BR:acs01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     100559401 (plcd3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
6
AA seq 802 aa AA seqDB search
MICGKWKKSRSESHRRGRHRHHQQQPPPPQTEPPVPAQTYGGVAAAAAKLSGHRAFKKLG
LTDDDDIKVMLRGSFFWKVKTHRPRKQRLYRLQEDGMTIWFETRFKKAYSQHVFSILHIE
SVREGYQSEGLRKYGGCFPEDQCFTIVFRGKRKNLDLAAISVNEAQQWVRGLKKLMARGE
AMSQREKLEHWIHDMLHQADKNKDNKMSFKEIKNMLRMINIDMNDIYAYRLFKECDRSNN
DRLEEYEIEEFCTRLMERPELKEIFHRYSGEDCVLSAEELREFLHDQGEEATIKRATDII
QTYELNERARQHNLMMLDGFMMYLLSSAGDVLNQNHTEIYQDMSQPLCHYFISSSHNTYL
TDNQIGGASSTEAYIRALMKGCRCVELDCWEGSNGEPIIYHGHTLTSKILFRDVIESIRD
YAFKHSSYPLILSLENHCGLEQQSTMARHMKAILGDMLLTQPLDGDVPKQLPSPEQLKWK
ILVKGKKLPEGKNELDRCNFSNPEEEMQDEEDDRSISSLQEIKPLQAKDAIQISRELSDV
VVYCQAVPFQSLSRALHNQQSNEMSSFSERKARKLIKESGNQFVRYNTRHLSRIYPQGLK
VNSSNYNPQEMWNAGCQLVALNFQTPGAEMDLNDGRFSVNGSCGYVLKPAFLRNTQSSFD
PEAPGRRAGQRPVALTIKVITAQQLPKLNKEKNSSIVDPFVRIEIYGVPVDCCKKQTEYQ
LNNGFNPRWNETLTFQVRIPELALVRFVVEDYDTTSANDFVGQFTLPLLSLREGYRHIHL
LSKDGTSLSPATLFVHVRCKKM
NT seq 2409 nt NT seq  +upstreamnt  +downstreamnt
atgatttgcggcaagtggaaaaagtcccgctcggaaagtcaccgccggggccgccaccgc
catcaccagcaacagccgccgccgccgcagacggagcctccggtccctgcccagacctat
ggaggagtcgccgccgccgccgccaagctttccgggcaccgcgcctttaagaagctgggc
ttgacagatgatgacgatattaaagtaatgctgagagggtcattcttctggaaagtcaag
acacacaggccacggaagcaaaggctctaccggcttcaggaagatggaatgactatctgg
tttgagacccgctttaaaaaggcttactcccaacatgtcttctccatcctgcacattgaa
agtgtgcgggaaggttaccaatctgaagggcttcggaaatatggcggctgttttcctgag
gaccagtgcttcactattgtcttccggggcaagaggaaaaacctggacctagcagccatt
agcgtgaatgaagctcagcagtgggtgagaggactcaagaaactgatggcaagaggtgaa
gccatgagccagcgggaaaaacttgagcattggatccatgatatgctgcatcaggctgac
aagaacaaagacaacaagatgagcttcaaagagatcaagaacatgttgcgcatgatcaac
attgacatgaacgacatctatgcatacaggctcttcaaggagtgtgacagatctaacaat
gaccgcttggaagaatacgagattgaggagttctgcacacggctaatggagcgtcctgag
ctgaaggagatcttccaccgttactcaggagaggactgtgtgctgtcggctgaggagctg
cgggaattcctgcatgaccaaggggaagaagccaccatcaagagggctactgatattatc
caaacttatgagctaaatgagagagccagacagcacaacctcatgatgttggatggtttc
atgatgtaccttctgtcctctgccggagatgtcctcaaccagaaccacacagaaatctat
caggatatgagccagccactgtgccattacttcatctcctcctcccacaacacctacctg
accgacaaccagattgggggagccagcagcaccgaggcgtatatccgggcattgatgaaa
gggtgtcgatgtgtggaacttgattgctgggagggctccaatggagagcctatcatctac
catggtcacacactcacctccaagatccttttccgggatgtaattgaaagcatccgggac
tatgcattcaagcactcctcctatcctctgattctctctctggaaaaccactgtggcctg
gaacaacaatctacaatggcccgccacatgaaggctattttgggggacatgctcttgacc
cagccactggatggagatgtgcccaaacaactcccatcaccagagcaattaaaatggaag
atattggtgaaggggaagaagctgccagagggaaagaatgagcttgacagatgcaacttc
tccaatcccgaggaagaaatgcaggatgaggaagatgatcggtctatatcttctctccaa
gagataaaaccattacaagcaaaagatgctatacagatttcacgagagctgtcagatgtg
gttgtttattgccaggctgtccccttccaaagcttgtctcgtgccctgcacaaccagcag
tctaatgagatgtcatctttcagtgagcggaaagcgaggaaactgatcaaggaatcggga
aaccaatttgtccggtacaatactcggcacctcagccgcatctatccgcagggcctgaag
gtgaactcctccaactacaaccctcaggaaatgtggaatgctggttgtcagcttgtggca
cttaatttccagactccaggcgcagagatggacttaaatgatggacgcttttccgttaat
ggcagttgcggctacgtgctaaagcctgcttttctacgcaacacccaaagttcttttgat
cctgaggctcctggtcgtagagctggccagcgccctgttgccctcaccatcaaggtgatc
actgctcaacagctacccaaactgaacaaagagaagaactcttcaattgtggatcccttt
gtgcgcattgaaatctatggagttccggtagattgttgcaagaagcaaactgagtaccag
ttaaacaatggattcaatccacgttggaatgagacactgacattccaagtacgaattcca
gagctggcgctggtacgatttgtagtcgaggattatgacacaacatctgccaatgacttc
gtgggacagtttactctgccactgctcagcctaagggaaggctaccgccatatacatcta
ctctccaaggatggcacatctctgtctccagccacactttttgtacatgtcagatgtaaa
aagatgtga

DBGET integrated database retrieval system