KEGG   Anolis carolinensis (green anole): 100559451Help
Entry
100559451         CDS       T01608                                 

Definition
uroporphyrinogen-III synthase-like
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
acs  Anolis carolinensis (green anole)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:acs00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    100559451
Enzymes [BR:acs01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     100559451
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
3
AA seq 265 aa AA seqDB search
MKVLLLKDPKESENGPDPYIEELGSHGLEATLIPVLAFEFISLQSLFEKLSCPEQYLGLI
FTSPRAVEAIKLCLADKSKKEDWKNYLREKWNTKSIYVVGKATAVLVAELGLIPQGENSG
NAEKLSGYICSRESPNSLPLLFPCGSLKRETLPTILREKGIALEILTVYQTTQHPDLQES
LRNYFSQQGVPASITFFSPSGVKYCLKQIMKLSGDLITQIKFAAIGPTTAEALETEGISV
SCTATSPTPQDLTTGIRRSLQLKDC
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtcctgttgctgaaggatcccaaagaaagtgaaaatgggccagatccatatata
gaagagctgggttcacatgggcttgaagcaacattgattccagttttagcgtttgaattt
atttcacttcagtccttgtttgaaaaactttcttgtcctgaacaatatctcggattaatt
tttacgagtccgagagctgtggaagctattaaattatgtctggctgataaatctaaaaag
gaagattggaaaaattatctgagggaaaaatggaacaccaaatcaatttatgtagtcgga
aaagctacagctgtactagtagctgaattaggacttataccacaaggagaaaactctggg
aatgctgaaaaactctctggatacatttgttcccgggaatcacccaactctttgcctctg
ctatttccatgtggcagtctgaaaagggaaacacttccaacaatactcagagaaaaaggt
attgcactggaaattctcactgtttatcaaactactcaacatcctgatcttcaagaatcc
ttgagaaattatttctcacaacagggtgttcctgcgagcatcacattttttagtccttct
ggtgtcaagtattgtctgaagcagattatgaaattatctggtgatctcattacccaaatt
aagtttgctgccataggtccaacaacagctgaagctctggaaactgaaggaatctcggtg
agctgtactgccactagccctactccacaggatctcaccacagggattagaagaagtctt
cagctcaaggattgctag

DBGET integrated database retrieval system