KEGG   Anolis carolinensis (green anole): 100559515Help
Entry
100559515         CDS       T01608                                 

Gene name
cdk4
Definition
(RefSeq) cyclin-dependent kinase 4
  KO
K02089  
cyclin-dependent kinase 4 [EC:2.7.11.22]
Organism
acs  Anolis carolinensis (green anole)
Pathway
Cell cycle
p53 signaling pathway
Tight junction
AGE-RAGE signaling pathway in diabetic complications
Module
Cell cycle - G1/S transition
Brite
KEGG Orthology (KO) [BR:acs00001]
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    100559515 (cdk4)
   04115 p53 signaling pathway
    100559515 (cdk4)
  Cellular commiunity
   04530 Tight junction
    100559515 (cdk4)
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    100559515 (cdk4)
Enzymes [BR:acs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     100559515 (cdk4)
Protein kinases [BR:acs01001]
 Serine/threonine protein kinases: CMGC group
  CDK family
   100559515 (cdk4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 303 aa AA seqDB search
MAMGRCEQYEPVAEIGIGAYGTVFKARDLQSGKFVALKNVRFQNSENGLPHSTVREVALL
KRLENFDHPNVVRLMDVCTTTRTERETKVTLVFEHVDQDLKAFLEKTPPPGLPAEMIKDM
MHQFLSGLDFLHTNCIVHRDLKPENILVTSSGQVKLADFGLARVYSCQMALTPLVVTLWY
RAPEVLLQSAYATPVDLWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEEDWPL
DVSLPRCAFAPCSPQPIERFVPEIDTLGIQLLLEMLTFNPLKRISAFQALHHQYFQDMSA
GEG
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atggccatggggagatgcgaacagtatgaacctgtggccgaaatcggcattggggcttat
ggcactgtcttcaaggcccgtgacctgcaaagtggcaagtttgtggcccttaagaatgtg
cgattccagaacagcgagaatgggttgccgcactccacggtccgtgaagtggccctgctg
aaacgcctggagaactttgaccaccccaacgttgtgcggctaatggacgtttgcacaaca
acacggacagagcgtgagaccaaagtaacattggtctttgagcatgtggatcaggatctg
aaagcatttttggagaaaactccgcctcctggcttaccagcagagatgatcaaggatatg
atgcatcagttcttgagtggcttggatttcctgcatacaaactgcattgttcatcgtgac
ctcaagccagaaaatatcttggtgaccagttctggtcaagtcaagttggctgactttggc
ctggctcgcgtctacagctgtcagatggccctgacacctctggtggtcactctctggtac
cgggctccagaagtgctgctccagtcagcttatgccacccctgtggacctgtggagtgtg
gggtgcatctttgcagagatgtttcgaaggaagcctctcttctgtggcaactccgaagct
gatcagctgggcaagatctttgatttgattgggctcccacctgaggaggattggcccctg
gacgtttctctgccacgctgtgcctttgctccctgctccccacagcctattgagaggttt
gtgccagaaatagacaccctggggatccagctgcttttggaaatgctgacattcaatccc
ttgaaacgcatctctgctttccaagcactgcatcatcagtactttcaggacatgagcgca
ggtgaagggtag

DBGET integrated database retrieval system