KEGG   Anolis carolinensis (green anole): 100559515Help
Entry
100559515         CDS       T01608                                 

Definition
cyclin-dependent kinase 4-like
Orthology
K02089  
cyclin-dependent kinase 4 [EC:2.7.11.22]
Organism
acs  Anolis carolinensis (green anole)
Pathway
Cell cycle
p53 signaling pathway
Tight junction
Brite
KEGG Orthology (KO) [BR:acs00001]
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    100559515
   04115 p53 signaling pathway
    100559515
  Cell communication
   04530 Tight junction
    100559515
Enzymes [BR:acs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     100559515
Protein kinases [BR:acs01001]
 Serine/threonine protein kinases: CMGC group
  CDK family
   100559515
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 303 aa AA seqDB search
MAMGRCEQYEPVAEIGIGAYGTVFKARDLQSGKFVALKNVRFQNSENGLPHSTVREVALL
KRLENFDHPNVVRLMDVCTTTRTERETKVTLVFEHVDQDLKAFLEKTPPPGLPAEMIKDM
MHQFLSGLDFLHTNCIVHRDLKPENILVTSSGQVKLADFGLARVYSCQMALTPLVVTLWY
RAPEVLLQSAYATPVDLWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEEDWPL
DVSLPRCAFAPCSPQPIERFVPEIDTLGIQLLLEMLTFNPLKRISAFQALHHQYFQDMSA
GEG
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atggccatggggagatgcgaacagtatgaacctgtggccgaaatcggcattggggcttat
ggcactgtcttcaaggcccgtgacctgcaaagtggcaagtttgtggcccttaagaatgtg
cgattccagaacagcgagaatgggttgccgcactccacggtccgtgaagtggccctgctg
aaacgcctggagaactttgaccaccccaacgttgtgcggctaatggacgtttgcacaaca
acacggacagagcgtgagaccaaagtaacattggtctttgagcatgtggatcaggatctg
aaagcatttttggagaaaactccgcctcctggcttaccagcagagatgatcaaggatatg
atgcatcagttcttgagtggcttggatttcctgcatacaaactgcattgttcatcgtgac
ctcaagccagaaaatatcttggtgaccagttctggtcaagtcaagttggctgactttggc
ctggctcgcgtctacagctgtcagatggccctgacacctctggtggtcactctctggtac
cgggctccagaagtgctgctccagtcagcttatgccacccctgtggacctgtggagtgtg
gggtgcatctttgcagagatgtttcgaaggaagcctctcttctgtggcaactccgaagct
gatcagctgggcaagatctttgatttgattgggctcccacctgaggaggattggcccctg
gacgtttctctgccacgctgtgcctttgctccctgctccccacagcctattgagaggttt
gtgccagaaatagacaccctggggatccagctgcttttggaaatgctgacattcaatccc
ttgaaacgcatctctgctttccaagcactgcatcatcagtactttcaggacatgagcgca
ggtgaagggtag

DBGET integrated database retrieval system