KEGG   Anolis carolinensis (green anole): 100559530Help
Entry
100559530         CDS       T01608                                 

Definition
cytochrome P450 2D14-like
Orthology
K07414  
cytochrome P450, family 2, subfamily D [EC:1.14.14.1]
Organism
acs  Anolis carolinensis (green anole)
Pathway
Steroid hormone biosynthesis
Brite
KEGG Orthology (KO) [BR:acs00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    100559530
Enzymes [BR:acs01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     100559530
Cytochrome P450 [BR:acs00199]
 Cytochrome P450, animal type
  CYP2 family
   100559530
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
5
AA seq 489 aa AA seqDB search
MSICLIIFALALLLDYMKRRKKCGRCPPGPAPLPFIGNILWFNRKNPSESFRQVEKIFGP
IFLVQAGWQNFVIINGFKLTKEALGSKAEDFIERPALPLIFLLGRTKKYEGIILATSHNG
WREQKRFCVSTLKTFGMGKKTLEKKVCEEAWYLCSELKSKEGSPFDPKISIFNATGNIIS
TLAFGDRFEYHDETFLKLIHSTEEILKDLTRMVPEIVFARSWFSYLPGPHQKIKKHYDNF
TAVLKIMVDEHKKTRDPTFPRDLIDAFLEEIEKAKGNPETSFGEENLIHLMIDLFAAGTD
TTSVTLLWGLLKMILYPEVQKRVQEEIDMVIGRIKSPTMEDQSKLPYTNAVIHEIQRYAD
IAPTTIPYMTYRDTEVANFVIPKATVVICHLSSVLKDETMWEKPHDFYPEHFLDANGKFI
KREAFLPFSAGRRACTGEQLAKTELFIFFTTLLQHFTFCIPENCPKPTEERIYAVTVTPA
PFQLCAIPR
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atgtctatttgtctcataatatttgccctagccctgctgctggattacatgaagcggagg
aagaaatgtggtcgctgtccaccgggacctgcccctctgcctttcattggaaacatcctc
tggtttaatagaaaaaatccaagtgaatctttccgacaagtggagaaaatctttggacca
atcttcttagtccaggcaggctggcaaaactttgttataataaatgggttcaagttaaca
aaggaggcactaggatcgaaagctgaggacttcattgagaggccagcactcccactaata
tttttattaggccgtacaaagaagtatgaaggcatcattttggcaacttcgcacaatggc
tggagggagcaaaagagattttgtgtttccacccttaaaacctttgggatggggaagaaa
acacttgaaaagaaagtatgtgaagaagcttggtatttgtgctctgagctgaaatctaaa
gaaggctctccatttgaccccaaaatctcaatctttaatgcaaccggtaatattattagt
acattagcatttggcgatcgctttgaataccatgatgaaaccttcctgaagttaatccac
tcgacagaagaaatactaaaggatttaacaagaatggtgcccgagattgtgtttgcaaga
tcatggttctcctatctccctggacctcatcagaaaatcaagaaacattatgataatttc
actgctgtcttaaaaataatggtggatgaacataagaaaaccagagatcccacttttccc
agagatctaattgatgcatttttggaagagatagaaaaggccaaaggaaatccagaaacc
agtttcggtgaagaaaaccttattcatcttatgattgacctgtttgcggcaggcactgac
acaacatctgtcaccctactctgggggcttctgaagatgatcctctatcctgaagttcag
aaaagagttcaagaagaaattgatatggtgattggccgaataaaatcacccacaatggag
gaccaatcaaaactgccttataccaatgctgtgatccatgaaattcaacgttatgccgat
attgcaccaactacaattccttatatgacatacagagatactgaagttgccaattttgtt
attcccaaggccactgttgtcatctgtcatttatcttctgtgctaaaggatgaaacaatg
tgggaaaaaccccatgacttttacccagagcacttcctggatgcaaatgggaagtttatc
aagcgagaagccttcctgcctttctctgcaggtcgtcgagcttgcactggagaacagttg
gctaaaacagagcttttcatcttcttcaccactctcctgcaacattttaccttttgcatt
ccagaaaactgtcccaaaccaacagaggaaagaatatatgctgtgacagtcaccccagcc
ccattccagctctgtgccattcctagatag

DBGET integrated database retrieval system