KEGG   Anolis carolinensis (green anole): 100559652Help
Entry
100559652         CDS       T01608                                 

Definition
1,4-alpha-glucan-branching enzyme-like
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
acs  Anolis carolinensis (green anole)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:acs00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    100559652
Enzymes [BR:acs01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     100559652
Exosome [BR:acs04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100559652
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
3
AA seq 682 aa AA seqDB search
MLNPSWYGIFHHILKSVEESEGGLDKFTKSYLTFGVNRFVDGGIYCKEWAPGAEAVFLTG
DFNNWNPFSHPYKKMDFGKWELFIPPGPDGFSPVSHGSKLKVVIRTRSGEVLYRISPWAR
YVAREGTNVNYDWIFWDPPNPYRRRHPVPKKPKSLRIYESHVGIASPEGKIASYKNFTHN
VLPKVKDLGYNCIQLMAVMEHAYYASFGYQITSFFAASSRYGPPDDLKELIDVAHSMGIT
VLLDVVHSHASKNSEDGLNNFDGTDNAFFHSGTRGVHALWDSRLFDYANWEVLRFLLSNL
RWWIEEYAFDGFRFDGVSSMLYHHHGIGEGFSGDYNEYFGMHVDEDALAYLVMANYMIHF
LHPECITVAEDVSGMPALCCPVKEGGCGFDYRLAMAVPDKWIQIIKELKDEDWDMGNIVF
TLTNRRYGEKYIAYAESHDQALVGDKTLAFRLMDAEMYNYMSVLTPLTPIIDRGIQIHKM
IRLITHALGGEGYLNFMGNEFGHPEWLDFPRKGNNESYHYARRQFHLADDQLLRYRFLND
FDRDMNKLEEIFGWLSSPPAYISEKHESNKVIAFERANLLFIFNFHPSKSYADYRVGTEK
PGKYPFLLDSDAPEYGGHNRLDHNTEFFTQNYSHNNRPNSLLQPRSLNESDGQPRGQLHT
YFLEVYIPSRVALVFQNMDIQN
NT seq 2049 nt NT seq  +upstreamnt  +downstreamnt
atgctcaatccaagctggtatggcatatttcatcacatcttgaagagtgttgaagaatct
gaaggtggcctcgataaattcacaaagagttacctaacatttggagtcaacagatttgtg
gatggcggaatatactgcaaagaatgggctcctggggctgaagcagtgtttctcactgga
gacttcaataactggaatccattttcccatccatacaagaaaatggattttgggaaatgg
gagttgttcatcccacctggaccagatggattttctcctgtgtctcatggatcaaaactg
aaggtggtgattcgaacccgaagtggagaggtcctctaccgtatttctccttgggcaaga
tatgtagctcgtgaaggtaccaatgttaactatgattggatattctgggacccaccaaac
ccatacaggcggagacatcctgttcctaagaagcctaaaagcttaaggatctatgaatct
catgtgggaattgcttcccctgaagggaaaatagcttcatataaaaacttcacacacaat
gtacttccgaaagtcaaggatcttggttataattgtattcagttgatggctgtgatggaa
catgcttactatgctagttttggttatcagatcacaagcttttttgcagcatcaagccgt
tacgggcctccagatgacctgaaggaactgatagatgttgcccattctatgggaattaca
gtcctgttggatgtggtacatagccatgcatctaagaattctgaagatggactgaacaac
ttcgatggtaccgacaatgccttttttcactctggtactagaggagtacatgcactctgg
gatagtcgactcttcgactatgcaaactgggaagtcttgcggtttcttctttctaaccta
aggtggtggatagaagaatatgcatttgatggctttcgatttgatggtgtatcttctatg
ctatatcatcatcatggtattggtgaaggcttcagtggagattataatgaatactttggt
atgcatgttgatgaagatgctctggcatacctggtgatggcaaactacatgattcatttc
ttacatccagaatgcataacagtggcagaggatgtgtctggaatgccagctctttgctgc
ccagtgaaagaaggaggatgtggatttgattatcggctggccatggcagttccagacaaa
tggatccagataattaaggagcttaaggatgaagactgggatatgggaaatatagtattc
acactaacaaacagacgatatggagagaaatatattgcatatgcagagagtcatgaccag
gcccttgttggtgataagactttggcatttcgtctgatggatgcagagatgtataactat
atgagtgtcctcacacctcttactccaattattgatcgtggcatacagattcataagatg
attcggctcattactcatgcacttggaggagagggctatctcaacttcatgggcaatgag
tttggacatccagaatggttggatttcccccgaaaagggaataatgaaagctaccattat
gctagaaggcagtttcatttagctgatgaccagcttcttcgctatagattcctcaatgat
tttgacagagatatgaacaaactggaagaaatatttggttggctttcatcacccccggct
tacatcagtgagaagcatgaatcaaacaaagttattgcatttgagagggcaaacctcttg
tttatattcaatttccatccatctaaaagttatgcagattatcgagtaggtacagaaaaa
cctggaaaatatccttttcttttggattctgatgctccagaatatggagggcataacaga
ctggaccataacacagaattcttcactcaaaattactcacataacaatagacctaattct
cttctgcaacccagatcactgaatgaaagtgatggccaaccccgaggacagctgcataca
tacttcctggaggtgtacattcccagcagagtggccttggtgttccaaaatatggatatc
cagaactga

  All links  
No link information was found.   
DBGET integrated database retrieval system