KEGG   Anolis carolinensis (green anole): 100559652Help
Entry
100559652         CDS       T01608                                 

Definition
1,4-alpha-glucan-branching enzyme-like
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
acs  Anolis carolinensis (green anole)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:acs00500]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
3
AA seq 682 aa AA seqDB search
MLNPSWYGIFHHILKSVEESEGGLDKFTKSYLTFGVNRFVDGGIYCKEWAPGAEAVFLTG
DFNNWNPFSHPYKKMDFGKWELFIPPGPDGFSPVSHGSKLKVVIRTRSGEVLYRISPWAR
YVAREGTNVNYDWIFWDPPNPYRRRHPVPKKPKSLRIYESHVGIASPEGKIASYKNFTHN
VLPKVKDLGYNCIQLMAVMEHAYYASFGYQITSFFAASSRYGPPDDLKELIDVAHSMGIT
VLLDVVHSHASKNSEDGLNNFDGTDNAFFHSGTRGVHALWDSRLFDYANWEVLRFLLSNL
RWWIEEYAFDGFRFDGVSSMLYHHHGIGEGFSGDYNEYFGMHVDEDALAYLVMANYMIHF
LHPECITVAEDVSGMPALCCPVKEGGCGFDYRLAMAVPDKWIQIIKELKDEDWDMGNIVF
TLTNRRYGEKYIAYAESHDQALVGDKTLAFRLMDAEMYNYMSVLTPLTPIIDRGIQIHKM
IRLITHALGGEGYLNFMGNEFGHPEWLDFPRKGNNESYHYARRQFHLADDQLLRYRFLND
FDRDMNKLEEIFGWLSSPPAYISEKHESNKVIAFERANLLFIFNFHPSKSYADYRVGTEK
PGKYPFLLDSDAPEYGGHNRLDHNTEFFTQNYSHNNRPNSLLQPRSLNESDGQPRGQLHT
YFLEVYIPSRVALVFQNMDIQN
NT seq 2049 nt NT seq  +upstreamnt  +downstreamnt
atgctcaatccaagctggtatggcatatttcatcacatcttgaagagtgttgaagaatct
gaaggtggcctcgataaattcacaaagagttacctaacatttggagtcaacagatttgtg
gatggcggaatatactgcaaagaatgggctcctggggctgaagcagtgtttctcactgga
gacttcaataactggaatccattttcccatccatacaagaaaatggattttgggaaatgg
gagttgttcatcccacctggaccagatggattttctcctgtgtctcatggatcaaaactg
aaggtggtgattcgaacccgaagtggagaggtcctctaccgtatttctccttgggcaaga
tatgtagctcgtgaaggtaccaatgttaactatgattggatattctgggacccaccaaac
ccatacaggcggagacatcctgttcctaagaagcctaaaagcttaaggatctatgaatct
catgtgggaattgcttcccctgaagggaaaatagcttcatataaaaacttcacacacaat
gtacttccgaaagtcaaggatcttggttataattgtattcagttgatggctgtgatggaa
catgcttactatgctagttttggttatcagatcacaagcttttttgcagcatcaagccgt
tacgggcctccagatgacctgaaggaactgatagatgttgcccattctatgggaattaca
gtcctgttggatgtggtacatagccatgcatctaagaattctgaagatggactgaacaac
ttcgatggtaccgacaatgccttttttcactctggtactagaggagtacatgcactctgg
gatagtcgactcttcgactatgcaaactgggaagtcttgcggtttcttctttctaaccta
aggtggtggatagaagaatatgcatttgatggctttcgatttgatggtgtatcttctatg
ctatatcatcatcatggtattggtgaaggcttcagtggagattataatgaatactttggt
atgcatgttgatgaagatgctctggcatacctggtgatggcaaactacatgattcatttc
ttacatccagaatgcataacagtggcagaggatgtgtctggaatgccagctctttgctgc
ccagtgaaagaaggaggatgtggatttgattatcggctggccatggcagttccagacaaa
tggatccagataattaaggagcttaaggatgaagactgggatatgggaaatatagtattc
acactaacaaacagacgatatggagagaaatatattgcatatgcagagagtcatgaccag
gcccttgttggtgataagactttggcatttcgtctgatggatgcagagatgtataactat
atgagtgtcctcacacctcttactccaattattgatcgtggcatacagattcataagatg
attcggctcattactcatgcacttggaggagagggctatctcaacttcatgggcaatgag
tttggacatccagaatggttggatttcccccgaaaagggaataatgaaagctaccattat
gctagaaggcagtttcatttagctgatgaccagcttcttcgctatagattcctcaatgat
tttgacagagatatgaacaaactggaagaaatatttggttggctttcatcacccccggct
tacatcagtgagaagcatgaatcaaacaaagttattgcatttgagagggcaaacctcttg
tttatattcaatttccatccatctaaaagttatgcagattatcgagtaggtacagaaaaa
cctggaaaatatccttttcttttggattctgatgctccagaatatggagggcataacaga
ctggaccataacacagaattcttcactcaaaattactcacataacaatagacctaattct
cttctgcaacccagatcactgaatgaaagtgatggccaaccccgaggacagctgcataca
tacttcctggaggtgtacattcccagcagagtggccttggtgttccaaaatatggatatc
cagaactga

DBGET integrated database retrieval system