KEGG   Anolis carolinensis (green anole): 100559688Help
Entry
100559688         CDS       T01608                                 

Definition
eukaryotic translation initiation factor 4E-like
Orthology
K03259  
translation initiation factor 4E
Organism
acs  Anolis carolinensis (green anole)
Pathway
RNA transport
mTOR signaling pathway
Insulin signaling pathway
Module
eIF4F complex
Class
Genetic Information Processing; Translation; RNA transport [PATH:acs03013]
Environmental Information Processing; Signal transduction; mTOR signaling pathway [PATH:acs04150]
Organismal Systems; Endocrine system; Insulin signaling pathway [PATH:acs04910]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 211 aa AA seqDB search
MAAAMMVNTHEEQQKHKTERGEVVMEHITKHPLQNRWALWFFKNDKSKTWQDNLQLVTKF
DTVEDFWALYSHIQLASKLTSGCDYSLFKDGIEPMWEDNWNKCGGRWLITLAKQQRHTEL
DRFWLETLLCLIGEMFSDYSDDVCGAVINIRTKGDKIAIWTREAENQDAVIHIGRIYKEH
LGLSSKVVIGYQAHADTATKSGSLMKNKFVV
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atggcagcagctatgatggtaaacacacacgaagagcagcagaagcacaagactgagaga
ggagaggtggttatggagcacatcaccaagcaccctctgcaaaacaggtgggccctatgg
ttcttcaaaaatgataagagcaagacctggcaggacaacttgcagcttgtcaccaaattt
gacactgtagaagacttttgggcgctgtatagccatatccagttggccagcaaattgact
tctggctgtgactactcccttttcaaggatggcattgaacctatgtgggaagataactgg
aacaagtgtggtggtcgttggcttatcacgttagccaagcagcagcggcatacagagctt
gaccgattctggttagagactttgctgtgcttgatcggagaaatgttcagtgactacagc
gatgatgtatgtggggcagtcatcaacatacgcaccaaaggagataagattgctatctgg
acccgggaggcagagaaccaggatgcagtcattcatattgggcgtatatacaaggagcat
ctgggcttatcttcaaaagtggtgattggttaccaagcccatgctgacacagccaccaag
agtgggtccctcatgaagaacaagtttgtggtgtga

DBGET integrated database retrieval system