KEGG   Anolis carolinensis (green anole): 100559697Help
Entry
100559697         CDS       T01608                                 

Definition
phosphoglycerate mutase 1-like
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
acs  Anolis carolinensis (green anole)
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:acs00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    100559697
   01230 Biosynthesis of amino acids
    100559697
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100559697
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    100559697
Enzymes [BR:acs01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     100559697
Exosome [BR:acs04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   100559697
  Exosomal proteins of melanoma cells
   100559697
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 257 aa AA seqDB search
MAAAAAYRLVLVRHGESAWNLENRFSGWYDADLSATGQEEARRGGEALRDANYEFDICFT
SVQKRAIRTLWTVLDAIDQMWLPVVRTWRLNERHYGGLTGLNKAETAAKHGEAQVKIWRR
SYDIPPPPMEPDHPFYSAISKDRRYADLTEDQLPTCESLKDTIARALPFWNEEIVPQIKD
GKRVLIAAHGNSLRGIVKHLEGMTEEAIMELNLPTGIPIVYELDKNLKPIKPMQFLGDEE
TVRKAMEAVAAQGKVKK
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggcagcggcgtataggctggtcttagtccggcacggagagagcgcctggaac
ctggagaaccgcttcagcgggtggtacgacgcggacctgagcgccaccgggcaggaagag
gcgaggcgcggcggagaggcgctgagagatgctaactatgagtttgacatctgcttcaca
tctgtgcaaaagagggcaatccgcactctctggactgtgctggatgctattgatcaaatg
tggttacctgttgtgagaacctggcgtctcaatgagaggcattatggtggtctgaccggc
ctcaacaaggctgagactgctgctaaacatggagaggcccaagtgaagatctggagacgt
tcctatgacatcccacctcctcccatggagccggatcaccctttctacagtgccatcagc
aaggaccgtcgctatgctgacctaactgaagatcagttgcctacatgtgagagcttgaaa
gatactattgcccgggccttgcccttctggaatgaggaaattgttccacagatcaaggac
ggcaagcgggtgctcattgctgcccatggcaacagtctccgtggcattgttaagcaccta
gaaggaatgactgaagaagccatcatggaactcaatctgcccactgggattcctattgtc
tatgagctggacaaaaatctgaagcctatcaagcctatgcagttcctgggagatgaggag
acagtccgcaaggccatggaagctgtggcagctcagggcaaggtcaagaagtga

DBGET integrated database retrieval system