KEGG   Anolis carolinensis (green anole): 100559770Help
Entry
100559770         CDS       T01608                                 

Gene name
clk1
Definition
CDC-like kinase 1
Orthology
K08823  
CDC-like kinase [EC:2.7.12.1]
Organism
acs  Anolis carolinensis (green anole)
Brite
Enzymes [BR:acs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     100559770 (clk1)
Protein kinases [BR:acs01001]
 Serine/threonine protein kinases: CMGC group
  CLK family
   100559770 (clk1)
Spliceosome [BR:acs03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    100559770 (clk1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
1
AA seq 484 aa AA seqDB search
MRYSKQTDYSDWDEKQHEDRHQGSSHHKRKRTSHSSAHDSKRCKYNDTQIYDSLYSDASS
FHERDNQERRYVEYRNNFSQLSESKHHCRDNESGYHNHSSKSSGHSGRSSYKRKHKTHHS
KSHHSHARSHRRKRSRSVEDDEEGHLICQSGDVLSARYEIVSILGEGAFGKVVECLDHKV
GGRHVAVKIVKNVDRYSEAARSEIEVLQHLNATDPHSTFCCVQMLEWFEHYGHVCIVFEL
LGLSTYDFIKENSFLPFSLDHIRKMAYQICKSVNFLHSNKLTHTDLKPENILFVKSDYTE
SYNSKLKRDERTLKNPDIKVVDFGSATYDHEHHSTLVSTRHYRAPEVILALGWSQPCDVW
SIGCILIEYYLGFTIFPTHDSKEHLAMMEKILGPLPVHMVQKTRKRKYFHHDQLDWDEHS
SAGRYVSRRCKPLKEFMQCHDADHENLFNLIQKMLEYDPAKRITLAEALEHPFFSSLNKK
NTVL
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgcggtactccaaacaaacagattattctgactgggatgaaaaacagcatgaggatcgc
catcaaggcagtagtcatcataagagaaaaagaacatcacatagcagtgctcatgacagc
aagcgctgcaagtataatgacacccaaatttatgatagcctttattcagatgccagttct
ttccatgaaagagataaccaggaacgtcgctatgttgaatacagaaacaactttagccaa
ctctctgaaagcaaacaccattgtagggacaatgaaagtggttatcacaaccacagtagc
aagtcatcagggcatagcggcagaagcagttacaaaagaaaacacaagactcaccatagc
aaatcacatcattcacacgcgaggagtcaccgaaggaaaagatcgaggagtgtagaggat
gatgaggagggtcacctgatctgtcagagtggagacgtactaagtgcaagatatgaaatt
gtgtctattctgggtgaaggtgcttttggaaaagtggtggagtgccttgatcacaaagtg
ggcggtagacatgtggctgtaaaaatagtaaaaaatgttgatagatactcagaagctgct
cgttcagaaatagaagtattgcagcacttaaatgcaacagatcctcacagcacattctgc
tgtgtccagatgttggaatggtttgagcactatggccatgtttgcattgtatttgaacta
ttgggactaagtacttacgacttcattaaagaaaacagttttttgccatttagtctggac
cacatcagaaaaatggcttaccagatctgcaaatctgtcaactttttgcattcaaacaaa
ctaactcatacagatttgaagcctgaaaacatcttgtttgtgaagtctgactacacagaa
agttataattccaaactgaaacgtgatgagcgtacactgaaaaatccagatattaaagtt
gtggatttcggaagtgcaacatatgaccatgaacatcacagcacccttgtgtctacaagg
cattacagagctcctgaagttattttggctttggggtggtcgcagccatgtgatgtctgg
agtattggttgtattcttattgaatattaccttggattcacaatttttccgacacatgac
agcaaagagcacctagcaatgatggaaaaaatactggggccactaccagtgcatatggtc
cagaaaacaagaaaacgcaaatacttccaccatgaccagttggattgggacgaacatagt
tctgctggcagatatgtttcaagacgttgcaagccactgaaggaatttatgcaatgccat
gatgctgaccatgaaaatctatttaacctcatacagaagatgttggaatatgatcctgcc
aaacgaattacacttgcagaagccttggagcatcccttcttttcttcactaaataaaaaa
aatacagttctgtag

DBGET integrated database retrieval system