KEGG   Anolis carolinensis (green anole): 100559887Help
Entry
100559887         CDS       T01608                                 

Definition
cytochrome c, somatic-like
Orthology
K08738  
cytochrome c
Organism
acs  Anolis carolinensis (green anole)
Pathway
Sulfur metabolism
Metabolic pathways
p53 signaling pathway
Apoptosis
Herpes simplex infection
Brite
KEGG Orthology (KO) [BR:acs00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    100559887
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    100559887
   04115 p53 signaling pathway
    100559887
 Human Diseases
  Infectious diseases
   05168 Herpes simplex infection
    100559887
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
Un
AA seq 105 aa AA seqDB search
MGDVEKGKKIFVQKCSQCHTVEKGGKHKTGPNLWGLFGRKTGQSAGFSYSDSNKNKGIVW
SETTLMEYLEDPKKYIPGTKMIFAGIKKKNERADLIAYLKKACSS
NT seq 318 nt NT seq  +upstreamnt  +downstreamnt
atgggtgatgttgaaaaaggtaaaaagatatttgttcaaaaatgttcgcagtgccacacg
gttgaaaaaggtggaaagcacaagacggggccaaatctttggggactctttggccgtaaa
acaggacaatctgccggattttcttactccgattcaaacaagaataaaggtattgtctgg
agtgaaactacattaatggaatatttggaggacccaaagaaatacattcctggaacaaaa
atgatttttgctggcattaaaaagaagaacgagagagcagatctcattgcatacttgaaa
aaagcatgctcttcatga

  All links  
No link information was found.   
DBGET integrated database retrieval system