KEGG   Anolis carolinensis (green anole): 100559971Help
Entry
100559971         CDS       T01608                                 

Definition
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase-like
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
acs  Anolis carolinensis (green anole)
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Module
Methionine salvage pathway
Brite
KEGG Orthology (KO) [BR:acs00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    100559971
Enzymes [BR:acs01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.53  acireductone dioxygenase (Ni2+-requiring)
     100559971
    1.13.11.54  acireductone dioxygenase [iron(II)-requiring]
     100559971
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 180 aa AA seqDB search
MVEAWYMDEAPGDQRKPHRQDPNQPASLEQLSQLGVFYWKLDADNYENDPQLAKIRKERN
YNWMDIITIHKDKMPNYEEKIKIFYEEHLHLDDEIRYILEGSGYFDVRDKDDKWIRIAME
KGDMITLPAGIYHRFTLDESNYVKAMRLFVGEPVWTAYNRPADHFPARAQYKQFLTQAVQ
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atggtggaggcctggtacatggacgaagccccgggggaccagcggaagccccaccggcag
gaccccaaccagcccgccagcctggagcagctcagccagctgggtgtcttctactggaaa
ttggatgctgacaactatgagaatgatccacaattagcaaagattcgaaaagagaggaac
tacaattggatggatataataacgatacataaagacaagatgccaaattatgaagaaaag
ataaaaatattttatgaagagcacttacacctggatgatgagattcgctacatcctggaa
ggaagtgggtattttgatgtccgcgataaagacgacaaatggatccggattgccatggaa
aagggagacatgatcacacttcccgctggcatctatcaccgatttaccctggacgagtct
aattatgtgaaggcaatgaggctctttgttggagaacctgtgtggacggcttacaacagg
ccagcggatcactttcctgctcgagcacagtacaagcagtttttgacacaagcagtacaa
taa

DBGET integrated database retrieval system