KEGG   Anolis carolinensis (green anole): 100560015Help
Entry
100560015         CDS       T01608                                 

Gene name
capn1
Definition
calpain 1, (mu/I) large subunit
Orthology
K01367  
calpain-1 [EC:3.4.22.52]
Organism
acs  Anolis carolinensis (green anole)
Pathway
Protein processing in endoplasmic reticulum
Apoptosis
Brite
KEGG Orthology (KO) [BR:acs00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100560015 (capn1)
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    100560015 (capn1)
Enzymes [BR:acs01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.52  calpain-1
     100560015 (capn1)
Peptidases [BR:acs01002]
 Cysteine Peptidases
  Family C2: calpain family
   100560015 (capn1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 714 aa AA seqDB search
MSEEVIVPVYCTGVSAQVQKQRAKDLGLGKHENAVKYLGQDYERLRNECLQSGGLFRDET
FPASAASLGFKELGPNSSKTYGVKWKRPTELCRNPLFIIDGATRTDVCQGALGDCWLLAA
IASLTLNDPLLHRVVPHGQSFQNGYAGIFHFQIWQFGEWVDVVVDDLLPTKDGKLVFVHS
AEGNEFWSALLEKAYAKLNGCYEALSGGSTSEGFEDFTGGVTEWYDLRKPPSDLFQIILK
ALERGSLMGCSIDITSAFDMEAVTFKKLVKGHAYSVTGGEQITYRGQRVSLIRIRNPWGE
VEWTGAWSDNSAEWNTVDPSVGQQLRIKMEDGEFWMSFQDFLREFSRLEICNLTPDALKS
RKFRKWNTTLYDGTWRRGSTAGGCRNYPATFWINPQFKVRLEEVDHDDEEDSREPGCSFV
MALMQKHRRRERRLGKDMETIGFAVYEVPPEYVGQPSVHLKRDFFLSNSSRARSEQFINL
REVSTRFKLPPGEYIVVPSTFDPNKEGDFVLRVFSENKAGTVEMDDDIQANLPDEKVLSE
GEIDEGFKQLFRQLAGADMEISVTELQTILNRIIGKHKDLRTKGFSLESCRSMVNLMDRD
GNGKLGLVEFNILWTKIRGYLVVFRKFDLDKSGTMSAYEMRMALESAGFKLNKKLYELII
TRYAEPDLAIDFDNFVCCLVRLETMFRFFQALDSDKDGIVTFDLVKWIQLTMFA
NT seq 2145 nt NT seq  +upstreamnt  +downstreamnt
atgtcggaggaggtcatcgtgcccgtttactgcaccggagtctcggcacaagtccagaag
cagcgagccaaagacctgggtttggggaaacacgagaacgccgtcaagtacttaggccag
gattacgaaaggctccggaacgagtgcttgcagagcggaggcctcttccgagacgagacc
ttcccggcctccgccgcctccttgggatttaaggagctggggccgaattcctccaagacg
tacggcgtcaaatggaaacggcccacggaactgtgccgcaacccgcttttcattatcgac
ggagccacccgcacggacgtctgccaaggagctctgggcgactgctggctcctcgccgcc
attgcctccctcaccctgaacgacccccttctccatcgtgtcgtccctcatgggcaaagc
ttccaaaacggctatgcggggatcttccatttccagatctggcagttcggcgagtgggtg
gacgtggtggtggatgacctgctgccaacaaaagacggcaagctggtgtttgtgcattcc
gcagaaggcaatgagttttggagcgctctgcttgagaaggcctatgccaagctgaatggc
tgctacgaggctctttccgggggaagcacctctgaaggctttgaagacttcactggaggt
gtgacggagtggtacgatctccggaagccacccagcgacctcttccagatcatcctgaag
gccctggagaggggatctctcatgggttgctccattgacatcacaagtgctttcgacatg
gaagcggtcactttcaagaagctggtgaaaggccacgcgtattcggtcaccggcggcgag
cagatcacctaccgcgggcagagggtgagcctgatacggatacgaaacccctggggggaa
gtggaatggaccggcgcttggagcgacaattccgcggagtggaacacggtggacccatcg
gtggggcagcaactgaggattaaaatggaagatggagaattctggatgtccttccaagac
ttcctccgggagttctctcgccttgagatctgcaacctcacgccggatgcgctgaagtcg
cgcaagttccggaagtggaacacgacgctttacgacggcacctggcggagagggagcacg
gcaggcggctgcaggaactacccagccacattctggatcaatccccaattcaaagtccgt
ctcgaggaggtcgaccacgatgacgaggaagacagccgggagcctggctgcagttttgtc
atggcgctgatgcagaagcaccggcgccgagagaggcgcctcggcaaggacatggagacc
attggctttgctgtctatgaggtaccaccggagtatgtagggcaaccctcggtccacctg
aagcgcgacttcttcctctccaactcctcgcgggcccgttctgagcagttcatcaacctg
cgcgaggtcagcacccgcttcaagctgcctcccggagagtatatcgtggtgccttccacc
tttgatcccaacaaggaaggggactttgtgctgagggtcttctctgagaacaaagcaggg
accgtggagatggacgacgacatccaggccaatctcccagatgagaaagtgctttccgag
ggcgagatcgacgagggcttcaagcaactcttcaggcagttggctggagcggatatggag
atcagcgttaccgaactgcagacaatcctcaacaggatcatcggaaaacacaaagacctc
cgaaccaaaggtttcagcttggagtcctgccgcagcatggtgaacctcatggacagggat
ggaaatgggaaactcggtttggtggagttcaacatcctttggaccaaaatcagaggctat
ttggtggtctttaggaagttcgatttggacaagtcgggaaccatgagtgcctatgagatg
cggatggctctggaatctgcaggtttcaagctgaacaagaagctctacgagttgatcatc
acccgctacgccgagcctgacttggcgatcgactttgacaacttcgtctgctgtttagtg
cgactggaaaccatgttccggtttttccaggccctggactctgacaaagatggcatcgtc
acctttgacttggttaagtggatccagctcaccatgtttgcctga

  All links  
No link information was found.   
DBGET integrated database retrieval system