KEGG   Anolis carolinensis (green anole): 100560015Help
Entry
100560015         CDS       T01608                                 

Gene name
capn1
Definition
(RefSeq) calpain 1
  KO
K01367  
calpain-1 [EC:3.4.22.52]
Organism
acs  Anolis carolinensis (green anole)
Pathway
Protein processing in endoplasmic reticulum
Apoptosis
Necroptosis
Cellular senescence
Brite
KEGG Orthology (KO) [BR:acs00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100560015 (capn1)
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    100560015 (capn1)
   04217 Necroptosis
    100560015 (capn1)
   04218 Cellular senescence
    100560015 (capn1)
Enzymes [BR:acs01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.52  calpain-1
     100560015 (capn1)
Peptidases [BR:acs01002]
 Cysteine Peptidases
  Family C2: calpain family
   100560015 (capn1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
Position
Un
AA seq 714 aa AA seqDB search
MSEEVIVPVYCTGVSAQVQKQRAKDLGLGKHENAVKYLGQDYERLRNECLQSGGLFRDET
FPASAASLGFKELGPNSSKTYGVKWKRPTELCRNPLFIIDGATRTDVCQGALGDCWLLAA
IASLTLNDPLLHRVVPHGQSFQNGYAGIFHFQIWQFGEWVDVVVDDLLPTKDGKLVFVHS
AEGNEFWSALLEKAYAKLNGCYEALSGGSTSEGFEDFTGGVTEWYDLRKPPSDLFQIILK
ALERGSLMGCSIDITSAFDMEAVTFKKLVKGHAYSVTGGEQITYRGQRVSLIRIRNPWGE
VEWTGAWSDNSAEWNTVDPSVGQQLRIKMEDGEFWMSFQDFLREFSRLEICNLTPDALKS
RKFRKWNTTLYDGTWRRGSTAGGCRNYPATFWINPQFKVRLEEVDHDDEEDSREPGCSFV
MALMQKHRRRERRLGKDMETIGFAVYEVPPEYVGQPSVHLKRDFFLSNSSRARSEQFINL
REVSTRFKLPPGEYIVVPSTFDPNKEGDFVLRVFSENKAGTVEMDDDIQANLPDEKVLSE
GEIDEGFKQLFRQLAGADMEISVTELQTILNRIIGKHKDLRTKGFSLESCRSMVNLMDRD
GNGKLGLVEFNILWTKIRGYLVVFRKFDLDKSGTMSAYEMRMALESAGFKLNKKLYELII
TRYAEPDLAIDFDNFVCCLVRLETMFRFFQALDSDKDGIVTFDLVKWIQLTMFA
NT seq 2145 nt NT seq  +upstreamnt  +downstreamnt
atgtcggaggaggtcatcgtgcccgtttactgcaccggagtctcggcacaagtccagaag
cagcgagccaaagacctgggtttggggaaacacgagaacgccgtcaagtacttaggccag
gattacgaaaggctccggaacgagtgcttgcagagcggaggcctcttccgagacgagacc
ttcccggcctccgccgcctccttgggatttaaggagctggggccgaattcctccaagacg
tacggcgtcaaatggaaacggcccacggaactgtgccgcaacccgcttttcattatcgac
ggagccacccgcacggacgtctgccaaggagctctgggcgactgctggctcctcgccgcc
attgcctccctcaccctgaacgacccccttctccatcgtgtcgtccctcatgggcaaagc
ttccaaaacggctatgcggggatcttccatttccagatctggcagttcggcgagtgggtg
gacgtggtggtggatgacctgctgccaacaaaagacggcaagctggtgtttgtgcattcc
gcagaaggcaatgagttttggagcgctctgcttgagaaggcctatgccaagctgaatggc
tgctacgaggctctttccgggggaagcacctctgaaggctttgaagacttcactggaggt
gtgacggagtggtacgatctccggaagccacccagcgacctcttccagatcatcctgaag
gccctggagaggggatctctcatgggttgctccattgacatcacaagtgctttcgacatg
gaagcggtcactttcaagaagctggtgaaaggccacgcgtattcggtcaccggcggcgag
cagatcacctaccgcgggcagagggtgagcctgatacggatacgaaacccctggggggaa
gtggaatggaccggcgcttggagcgacaattccgcggagtggaacacggtggacccatcg
gtggggcagcaactgaggattaaaatggaagatggagaattctggatgtccttccaagac
ttcctccgggagttctctcgccttgagatctgcaacctcacgccggatgcgctgaagtcg
cgcaagttccggaagtggaacacgacgctttacgacggcacctggcggagagggagcacg
gcaggcggctgcaggaactacccagccacattctggatcaatccccaattcaaagtccgt
ctcgaggaggtcgaccacgatgacgaggaagacagccgggagcctggctgcagttttgtc
atggcgctgatgcagaagcaccggcgccgagagaggcgcctcggcaaggacatggagacc
attggctttgctgtctatgaggtaccaccggagtatgtagggcaaccctcggtccacctg
aagcgcgacttcttcctctccaactcctcgcgggcccgttctgagcagttcatcaacctg
cgcgaggtcagcacccgcttcaagctgcctcccggagagtatatcgtggtgccttccacc
tttgatcccaacaaggaaggggactttgtgctgagggtcttctctgagaacaaagcaggg
accgtggagatggacgacgacatccaggccaatctcccagatgagaaagtgctttccgag
ggcgagatcgacgagggcttcaagcaactcttcaggcagttggctggagcggatatggag
atcagcgttaccgaactgcagacaatcctcaacaggatcatcggaaaacacaaagacctc
cgaaccaaaggtttcagcttggagtcctgccgcagcatggtgaacctcatggacagggat
ggaaatgggaaactcggtttggtggagttcaacatcctttggaccaaaatcagaggctat
ttggtggtctttaggaagttcgatttggacaagtcgggaaccatgagtgcctatgagatg
cggatggctctggaatctgcaggtttcaagctgaacaagaagctctacgagttgatcatc
acccgctacgccgagcctgacttggcgatcgactttgacaacttcgtctgctgtttagtg
cgactggaaaccatgttccggtttttccaggccctggactctgacaaagatggcatcgtc
acctttgacttggttaagtggatccagctcaccatgtttgcctga

DBGET integrated database retrieval system