KEGG   Anolis carolinensis (green anole): 100560311Help
Entry
100560311         CDS       T01608                                 

Definition
(RefSeq) monoacylglycerol lipase ABHD6-like
  KO
K13700  
abhydrolase domain-containing protein 6 [EC:3.1.1.23]
Organism
acs  Anolis carolinensis (green anole)
Brite
Enzymes [BR:acs01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     100560311
Peptidases [BR:acs01002]
 Serine Peptidases
  Family S33
   100560311
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
2
AA seq 263 aa AA seqDB search
MSERIKVRPGDKEELQQAEMELCLHRIFKRTLTFILSVLIFTFLTMYHLGPSLKIFQIMM
WYKRQKRGVKVKYVEHEGYRFCYFSRGQPGLQPSILMLHGFSFNKDVWLNAIKLFPKGLH
LVCLDMPGHGETTRLLGESYTAATQAQRIHQFVKCIDMDRKPFHLVGTSTGGMVAGLYAI
LYPSDVCCLSLLCPAGLRYPKASDLVKYLKKQKRSMQSHNFLKHGVYHSSRTNLQHLKGY
LAASRPDKAFYINCKCNCMTTKN
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgtcagaaaggattaaagtcagaccaggtgataaagaagaacttcaacaagcagagatg
gaattgtgcttgcacaggatattcaagaggaccttgaccttcattctgtctgtcttgata
tttaccttcctcaccatgtaccacctgggaccttcactaaagatattccagatcatgatg
tggtacaaacgtcagaaaaggggcgtgaaggttaaatatgtggagcatgaaggctatagg
ttctgttacttctcccgtggccaacctggactccagccctccattctgatgcttcatggg
ttctcattcaacaaagacgtgtggttaaatgccatcaagctctttcctaagggccttcac
ttggtctgccttgacatgcctggacatggagaaactactcgtttgctaggagaaagttac
acagcagcaactcaggctcaaaggatacatcagtttgtcaagtgcatcgatatggataga
aagcctttccacttggttggcacttccacaggaggaatggtagctgggctttatgctata
ctttatccatctgatgtctgctgcttatcactcctgtgcccagctggtctgaggtaccca
aaagctagtgacttggtcaagtacttgaagaagcagaagcgatccatgcaatcacacaac
tttcttaaacatggtgtataccattccagccgaacaaatctgcagcatctcaagggatac
cttgcagcttcgagaccagataaagctttttatataaactgtaagtgcaattgcatgaca
acaaagaactaa

DBGET integrated database retrieval system