KEGG   Anolis carolinensis (green anole): 100560434Help
Entry
100560434         CDS       T01608                                 

Gene name
rptor
Definition
(RefSeq) regulatory associated protein of MTOR complex 1
  KO
K07204  
regulatory associated protein of mTOR
Organism
acs  Anolis carolinensis (green anole)
Pathway
Autophagy - animal
mTOR signaling pathway
Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:acs00001]
 Environmental Information Processing
  Signal transduction
   04150 mTOR signaling pathway
    100560434 (rptor)
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    100560434 (rptor)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    100560434 (rptor)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
2
AA seq 1351 aa AA seqDB search
MELDMLQSPLLGLGEEDESDMTDWNLPLAFMKKRHCEKIEGSKSLAQSWRMKDRMKTVSV
ALVLCLNVGVDPPDVVKTTPCARLECWIDPLSMGPQKALETIGANLQKQYENWQPRARYK
QSLDPTVDEVKKLCTSLRRNAKEERVLFHYNGHGVPRPTVNGEIWVFNKNYTQYIPLSIY
DLQTWMGSPSIFVYDCSNAGLIVKSFKQFALQREQELEVAAINPNHPLAQMPLPPSMKNC
IQLAACEASELLPMIPDLPADLFTSCLTTPIKIALRWFCMQKSVRLVPGVTLDLIEKIPG
RLNDRRTPLGELNWIFTAITDTIAWNVLPRDRFQKLFRQDLLVASLFRNFLLAEKNNEVL
QLHPVSSPRLPPTYMHAMWQAWDLAVDICLSQLPTIIEEGTAFRHSPFFAEQLTAFQVWL
TMGVENRNPPEQLPIVLQVLLSQVHRLRALDLLGRFLDLGPWAVSLALSVGIFPYVLKLL
QSSARELRPLLVFIWAKILAVDSSCQADLVKDNGHKYFLSVLADPYMPAEHRTMTAFILA
VIVNNYNTGQEACLQGNLIAICLEQLNDPHPLLRQWVAICLGRIWQNFDSARWCGVRDSA
HEKLYSLLSDPIPEVRCAAVFALGSFVGNSAERTDHSTTIDHNVAMMLAQLINDGSPMVR
KELVVALSHLVVQYESNFCTVALQFMEEEKNYTLPSPAAPEGGSLTPVRDSPCTPKLRSV
SSYGNIRAVTTARNLNKSLQNLSLNEETGSSVAFSPGNLSTSSSASSTLGSPENEEYILS
FETIDKMRRVSSYSSLNSLIGVSFNSVYTQIWRVLLHLAADPYPDVSDLAMKVLNSIAYK
ATVNARPQRILDTASLTQSAPASPTNKGMHIHQVGGSPPTTSTSSSSLTNDVTKQPVSRD
ISSVRPANVGNVGVQYTPHSHQFPRTRKMFDKGPDQTADDADDNVGHKNFMSTTMQTGFC
DWSAKYFAQPVMKIPEEHDLESQVRKEREWRFLRNARVRKQAQKIIQKGISRLDDQIFLN
RNPGMPSVVKFHPFTPCIAVADKDSICFWDWEKGEKLDYFHNGNPRYTRITSMEYLNGQD
CSLLLTATDDGAIRVWKNFADLEKNPEMVTAWQGLSDMLPTTRGLARRVSIYLDRSKQGG
AGMVVDWEQETGLLMTSGDVRIIRIWDTDREMKVQDIPTGADSCVTSLSCDSHRSLIVAG
LGDGSIRVYDRRMALSECRVMTYREHTAWVVKAYLQKHPEGNIMSVSVNGDVRFFDPRMP
ESVKVLQIVKGLTALDIHPQANLFACGSMNQFTAIYNGNGELINNIKYYDGFMGQRVGAI
SCLAFHPHWPHLAVGSNDYYISVYSVEKRIR
NT seq 4056 nt NT seq  +upstreamnt  +downstreamnt
atggagttagatatgttgcagtctccccttctggggcttggggaggaagatgaatcagac
atgactgactggaatctgcctttggccttcatgaagaagcggcactgtgagaagattgaa
gggtccaagtcattggctcagagttggcggatgaaagaccggatgaagaccgttagtgtt
gccttagtattgtgcctaaatgttggcgtggaccctcctgatgtggtgaagacaacgcca
tgtgctcgtcttgaatgttggatagatcctctgtcaatggggccgcagaaagctttggaa
acaattggtgcaaatttgcagaaacagtatgaaaattggcaaccaagggcccgatacaaa
cagagccttgatcctacagtggatgaagttaagaagctatgtacatcactgcgtcgaaat
gccaaggaagagagggtccttttccactacaatggacatggtgtccccaggcccacagta
aatggagaaatctgggtgttcaataagaactacactcaatacatcccattatccatatat
gacctacagacatggatgggcagcccctccattttcgtgtatgattgctccaatgctgga
cttattgtcaaatctttcaaacagttcgccttgcaaagggagcaggagctggaggtggca
gcaattaatccaaaccatccactggctcaaatgcccttgcctccttcaatgaaaaattgc
attcagctggcagcttgtgaagctagtgagttgctgccaatgatccctgacctaccagcc
gacctgttcacatcctgccttactacaccaatcaagattgcactgagatggttttgcatg
cagaagagtgtgagactcgtaccaggagtcacgttggatttaattgaaaaaattcctggg
aggctgaatgacaggcgaacgcctctgggagaattgaattggatctttacagccattaca
gatacaattgcatggaatgtcctacccagagaccgtttccaaaagctcttcaggcaggat
ctgttagtggcaagcctctttcgaaacttcttactggcggaaaagaataatgaggtctta
caactgcacccagtcagcagccctcgtttacctccaacctacatgcatgccatgtggcaa
gcttgggaccttgctgtggatatttgcctttctcaattgcctactataattgaggaagga
actgcattcaggcacagcccattctttgccgaacagctcacagcatttcaggtatggctg
acgatgggagtagaaaaccgcaatccgcctgaacagcttcccattgtcctgcaggtgctg
ttgagtcaagtgcatcggctgcgagcccttgatttactgggtcgatttttggatctgggt
ccttgggctgttagcttggcattgtctgttggcattttcccctatgtgttaaagctactt
cagagttctgctagggagctaagacctcttctggtcttcatctgggccaaaatccttgca
gtggacagttcatgccaagctgaccttgtgaaagacaatggccacaaatacttcctttct
gttttggcagatccctacatgccggctgaacacaggacaatgacagctttcatcctggca
gtgattgttaacaactacaatacagggcaggaagcctgtcttcaagggaaccttattgcc
atttgtctggagcagctaaatgacccacatcctcttctacgccagtgggtagctatttgc
ttaggacgtatctggcaaaattttgactctgccaggtggtgtggagtgagagacagtgcc
catgaaaagctctacagccttctgtctgacccaatcccagaggttcgctgtgctgcagtc
tttgcccttggtagctttgtaggcaattcagctgagcggactgatcactctactacaatt
gatcacaacgttgcaatgatgctggctcagctcatcaatgatggaagtcccatggtccga
aaggagttggtggttgcattgagtcaccttgtagtccagtatgaaagcaatttctgcact
gttgccttgcagtttatggaagaagaaaagaattacacactgccttcacctgctgctcca
gagggtggaagcctgactccagtgagggacagcccctgcacaccaaaactccgttctgtc
agctcctatgggaatatccgagcagtcaccacagcaaggaacttgaataagtctctgcag
aatctcagcttgaatgaagaaactggaagctctgttgcattttctcctgggaacctgagc
accagcagcagtgccagcagcaccttgggcagccctgagaatgaggagtatatcctgtcc
tttgagaccattgacaagatgagaagagtcagctcctactcatcactgaattccttgata
ggggtttctttcaacagtgtttacacacagatttggagagtccttttgcacctagctgct
gacccatacccagatgtttcagacttagctatgaaagtgctcaacagtattgcttacaag
gcaactgtaaatgcccgtccccagcgcatccttgacactgcatccctaacacagtctgcc
ccagccagtccaacaaataaaggcatgcacatacaccaagtgggagggtcaccaccaacc
actagcaccagtagctccagtttgaccaatgatgtgacaaagcagcctgtcagccgggat
atctcttctgtaagacctgcaaatgtgggtaatgtgggagtgcaatacacacctcactcc
caccagtttcctagaacaaggaaaatgtttgacaagggtccagaccagacagcggatgat
gctgatgataatgtcggacacaaaaacttcatgtcaacaacaatgcaaacagggttttgt
gattggagtgccaagtactttgcgcagccagtgatgaagattccagaagaacatgatttg
gagagccaggtccgaaaagagagggagtggaggttcttgcgcaatgcccgagtcaggaag
caggcacagaaaatcatccaaaaaggcatttcccgactagatgatcaaatctttctgaac
agaaaccccggcatgccctcagtagtcaaatttcacccatttaccccatgtatagcagtg
gctgataaagacagcatctgtttttgggattgggaaaaaggggagaagctggattatttt
cacaatggaaacccacgctacacaaggatcacatccatggaatacttgaatggacaagac
tgctccctgcttttaacagctacagatgatggtgctataagggtgtggaaaaactttgct
gacctggagaaaaatccagagatggtaaccgcctggcagggcttgtcagacatgctgcca
acaactcgtggtctggcccgaagggtttcaatctatcttgacagaagtaaacagggagga
gcagggatggtggtagactgggaacaagaaactggccttctcatgacttcaggagatgta
cggattatccgaatctgggatacagaccgagaaatgaaagtgcaggatattcccacaggg
gctgacagctgtgtcaccagcctgtcctgtgactctcatcggtcactaattgtagcagga
ctgggtgatggctccattcgtgtttatgacaggcggatggctctcagtgaatgccgtgtg
atgacctaccgagagcatacagcctgggtagtgaaagcatatttgcagaaacatcctgaa
ggcaacatcatgagtgtcagtgtaaatggagatgtccgtttcttcgatccgagaatgcca
gaatcagtgaaggtccttcagatagtcaaagggctgacagcgctggatattcatccacaa
gccaacctatttgcttgtggctccatgaatcagtttacggcaatctataatgggaatggt
gagctgatcaacaacatcaagtactatgatggattcatgggccagagagtgggtgccatc
agctgcttagccttccacccccactggccgcacctggcagtcggaagcaatgactactat
atctcagtgtactcggtggagaaacggatcagataa

DBGET integrated database retrieval system