KEGG   Anolis carolinensis (green anole): 100560511Help
Entry
100560511         CDS       T01608                                 

Gene name
gria4
Definition
glutamate receptor, ionotrophic, AMPA 4
Orthology
K05200  
glutamate receptor 4
Organism
acs  Anolis carolinensis (green anole)
Pathway
Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:acs00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100560511 (gria4)
Ion channels [BR:acs04040]
 Glutamate-gated cation channels
  Glutamate (ionotropic), non-NMDA
   100560511 (gria4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
3
AA seq 902 aa AA seqDB search
MRIICRHLVLLFSGFWGLAMGAFPSSVQIGGLFIRNTDQEYTAFRLAIFLHNTSPNASEA
PFTLVPHVDNIETANSFAVTNAFCSQYSRGVFAIFGLYDKRSVHTLTSFCSALHISLITP
SFPTEGESQFVLQLRPSLQGALLSLLGHYKWSRFVFLYDTDRGYSILQAIMETAGEKSWQ
VSAICVENFNDASYRQLLEDLDRRQEKKFVIDCEIERLQNLLEQIVSVGKHVKGYHYILA
NLGFKDISLDRFMHGGANVTGFQLVDFDTPMVAKLMQRWKKLDQREYPGSESPPKYTSAL
TYDGVLVMAETFRNLRRQKIDISRRGNAGDCLANPAAPWSQGIDMERTLKQVRIQGLTGN
VQFDHYGRRVNYSMDVFELKSTGPRKIGYWNDMDKLVLIQHEPTLGNDTSALENRTVVVT
TIMEAPYVMWKKNRELFDGNEKYEGYCVDLASEIAKHIGIKYKIAIVPDGKYGARDPNTK
IWNGMVGELVYGKAEIAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFL
DPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHTEEPEDGKEGPSDQPPNEFGIFNSLW
FSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAED
LAKQTEIAYGTLDSGSTKEFFRRSKIAVYEKMWAYMSTTDPSVFARTTAEGVARVRKSKG
KFAFLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGVATPKGSSLRTPVNLAVLKLSEAGV
LDKLKNKWWYDKGECGPKDSGSKDKTSALSLSNVAGVFYILVGGLGLAMLVALIEFCYKS
RAEAKRMKLTFSEAIRNKARLSITGSVGENGRVLTPDCPKAVHSGTAIRQSSGLAVIASD
LP
NT seq 2709 nt NT seq  +upstreamnt  +downstreamnt
atgaggattatttgcagacaccttgtcttgttgttttctggcttttggggactcgcgatg
ggcgcttttcctagcagcgtgcaaataggtggcctcttcatcagaaacaccgatcaggaa
tatactgcttttcggttagcgatttttcttcacaacaccagccccaatgcgtccgaagca
ccgtttactttggttccacacgtagacaacattgaaacagcaaacagcttcgctgtaaca
aatgccttctgctcccagtactcaagaggagtatttgccatttttggactatacgacaaa
agatctgtacataccttgacctcattctgcagcgccttgcacatctcgctcatcacaccg
agtttccccaccgagggagagagccagtttgttctgcaactgaggccttccttacaggga
gcgttgctaagtttgcttggccattataaatggagccgcttcgtcttcctttacgacaca
gataggggttactcaatacttcaagctattatggaaacagcaggagaaaaaagctggcaa
gtcagtgccatttgtgtggagaattttaatgatgcgagctacaggcagcttttagaagac
ttggatcggagacaggaaaagaaattcgtaatagattgtgaaatagagaggcttcagaat
ctcttagaacagattgtgagtgttgggaagcatgttaaaggctaccattacatcttagca
aatctgggtttcaaggatatttctttggaccggtttatgcatggaggagctaatgtcact
ggatttcagctagtggattttgatacaccaatggttgctaaactcatgcaacggtggaag
aaactggatcaaagagaatacccaggatcggaatctcctcctaagtatacctctgctctc
acctacgatggggtgcttgtgatggctgagactttccgtaatcttcgaagacagaaaatt
gatatttctcggagagggaatgctggggattgcctcgcaaatccggctgcaccatggagt
caagggattgacatggagagaacgctgaaacaggttcgaatacaaggactgacagggaat
gttcagtttgatcactatggtcgccgagttaactattcaatggatgtgtttgaattgaag
agtactggccctcgaaagattggttactggaatgatatggataagttggttttgattcag
catgagcctacattgggaaatgacacatccgctcttgagaacagaacagtcgttgtaacc
acaattatggaagccccgtatgttatgtggaaaaaaaacagagaactgtttgatgggaat
gagaaatatgaaggatactgtgtagacctggcatcggaaattgcaaagcatattggcatc
aagtacaaaattgcaattgtccctgatggaaaatatggagcaagggatccaaacacaaaa
atatggaatgggatggtgggagagctggtatatgggaaagcagaaattgctgttgcacct
ctgacaattactttggtacgagaggaggtcattgatttttctaagccctttatgagtctt
ggcatatccattatgatcaaaaagccccagaaatctaaacctggagttttttctttcctg
gatcccttggcatatgaaatatggatgtgcattgtctttgcctacattggggtcagtgtg
gtcctgttcctggtgagcaggtttagtccatacgaatggcacacagaagagccagaggat
ggcaaagaaggcccgagtgaccagcctcccaatgaatttggcatcttcaacagcctctgg
ttttccctgggtgcctttatgcaacaaggatgtgatatttcacccagatccctctcaggt
cgcatagttggaggtgtgtggtggttcttcacactcatcattatttcatcctacactgct
aatcttgctgctttcttgacggttgagcgaatggtctcgcccatagaaagtgctgaagac
ctagccaaacaaactgagattgcatatggaacactggactcggggtcaacaaaagaattc
ttcagaagatctaaaatagcagtgtatgaaaagatgtgggcatacatgagcacaacagat
ccatcagtgttcgctaggactacggctgagggagttgcccgtgttcgcaaatccaagggc
aagtttgccttcctcctggagtccaccatgaatgaatacattgagcagcgaaagccatgt
gacaccatgaaagtgggaggaaatctggattcgaaaggctatggcgtagccacaccaaag
ggttcttcattaagaactcctgtaaaccttgccgttttgaaactcagtgaggcaggcgtc
ttagacaagctgaaaaacaaatggtggtacgataaaggtgaatgtggacccaaggactct
ggaagtaaggacaagaccagcgccctgagtctcagcaacgtggccggtgtcttctacatt
ctggttggcggcctgggcttggctatgctggtggctttgatagaattctgttacaaatcc
agggcagaggcgaagagaatgaagctgaccttttcagaagccatacgaaacaaagccaga
ttatccatcacagggagcgtgggggagaacggccgcgtcctcactcccgactgcccaaag
gctgtacactccggaacggcaattagacaaagttcaggattggcggtaattgcatcagac
ctaccataa

DBGET integrated database retrieval system