KEGG   Anolis carolinensis (green anole): 100560516Help
Entry
100560516         CDS       T01608                                 

Definition
ubiquitin carboxyl-terminal hydrolase 49-like
Orthology
K11834  
ubiquitin carboxyl-terminal hydrolase 44/49 [EC:3.1.2.15]
Organism
acs  Anolis carolinensis (green anole)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
4
AA seq 725 aa AA seqDB search
MEMFQPGVIELREYFNMNRLNHWSFMXDMDRCKHVGRLRLAQDHSILNPQKWHCMDCNTT
ESIWACLKCSHVACGRYIEDHALKHFEETRHPLAMEVNDFYVFCYLCEDYVLNDNPEGDL
KLLRSSLSAIKSQKHDPSARSGRTLRSMALGEDVCNHQRAPQGRPQMLTALWYRRQSLLA
KALRTWFDKSSRGQQKLEQKRQMEELEIKKEMARQRRQEMKRRLLEELASTPPRKSARLL
SHIRRENLIPRKFRDMEASSPTSRRVQSSRFKQFYSIRRKPLMTPGVTGLKNLGNTCYMN
SILQVLSHLQKFRECFLTLDLCETEELLAKTVNGKSRMSGKLVSGLGPTESGRNDQLGSY
GRQSLPAGLNGGSSISKSLELTQPKEPSSKHISLCHELHTLFRVMWSGKWASVSPFAMLH
SVWSLIPAFRGYDQQDAQEFLCELLDKVQQELESEGTKRRILIPFSQRKLTKQVLKVVNT
IFHGQLLSQVTCITCNYKSNTVEPFWDLSLEFPERYHSINKGIVPVNQTECMLTEMLAKF
TETEALEGRIYACDQCNSKRRKSSPKPLILSEAKKQLMIYRLPQVLRLHLKRFRWSGRNH
REKIGVHVLFDQVLNMEPYCCRDTLSSLDKETFVYDLSAVVMHHGKGFGSGHYTAYCYNT
EGGFWVHCNDSKLNVCSVEEVCKTQAYILFYTQRTVQGKASISETQLQAQVLSKHNDKDR
RLTLP
NT seq 2178 nt NT seq  +upstreamnt  +downstreamnt
atggagatgttccagcctggggtcattgagttgcgagagtatttcaatatgaatcggtta
aatcattggagctttatgtaagacatggatagatgcaaacatgttgggcggctacgactt
gcccaagaccactctattctgaacccccagaagtggcactgcatggactgcaacaccaca
gaatccatttgggcttgcctgaaatgctcccatgtggcctgtggaagatatattgaagac
catgcacttaaacactttgaagaaaccaggcatcctttggcaatggaagtaaatgatttc
tatgtcttctgttacctttgtgaagactatgtattgaatgataatcccgagggtgacttg
aaattactaagaagttctctatcggcaattaaaagtcagaagcatgacccatctgctaga
agtgggaggacgctgcggtcaatggctttgggggaggatgtttgcaaccatcagagggcc
cctcagggacggcctcagatgcttacagccctttggtacagacggcaatcattgctagca
aaagcactgaggacctggtttgataagagttctagaggccaacaaaagctagaacaaaag
agacaaatggaagaactagagattaaaaaagaaatggccaggcagcggcgtcaagagatg
aaacggagattattggaggaactggcgagcacccctccaagaaaaagtgccaggcttttg
tcacatattcgcagagagaatctgattcctcgaaagttcagagacatggaagcaagttcc
cctacctcaagacgagtgcaaagtagcagattcaaacagttttattccattcgtcggaag
cctctcatgactcctggtgtgactggactaaagaatcttggaaatacctgctacatgaat
tctatccttcaagtattaagtcacctccagaagtttagagaatgttttttgacgctggat
ctctgtgaaactgaagaactcttagctaagaccgtgaatggaaagtctagaatgtctgga
aagctggtcagtgggcttggtcctaccgagtcagggaggaatgatcaattgggttcatat
ggcaggcagagcctgcctgctggcttgaatggcgggtcctcaataagcaaaagtttagaa
ctaacacagcccaaggagccaagttcaaagcacatctctctctgtcatgaacttcacaca
cttttcagagttatgtggtctgggaagtgggcttcagtgtctccttttgctatgctacac
tctgtatggagtctgattccagcgtttcgaggttatgaccagcaagatgctcaggaattt
ctctgtgaattgttggacaaggtgcagcaggagctggaatctgaaggaacaaaacgaagg
atcctaatccccttttcacagaggaagctcaccaagcaagtcctgaaagtggtgaacacc
atttttcatgggcagctactcagtcaggttacctgtataacatgtaactataaatccaat
actgtggaacccttctgggatctttccctggaattccctgaacgctatcactccatcaac
aaagggattgtgcctgttaatcaaacagagtgtatgcttactgaaatgctggccaaattc
acagaaacagaagctttggaagggagaatttatgcatgtgaccagtgcaacagcaaacga
cggaagtcttctcccaaacctctcatactaagcgaagctaaaaagcagttaatgatctac
agactacctcaggtcctccgactgcaccttaaacgattcaggtggtctggacgtaatcac
cgtgagaagattggggtccatgtcctctttgaccaggtattaaacatggaaccttactgc
tgcagggacactctctcctctcttgacaaagagacctttgtctatgacctctcggctgtg
gtgatgcatcatgggaaagggtttggctcaggacattacacggcttattgctacaacacg
gagggagggttttgggtccactgcaatgactccaaactgaatgtatgtagtgtggaggag
gtatgcaaaacccaggcctacattcttttttatactcaaagaaccgtgcagggcaaagca
agtatctcagaaacacaacttcaagctcaggtgctgtccaaacacaatgataaagacaga
agattgacactcccatga

DBGET integrated database retrieval system