KEGG   Anolis carolinensis (green anole): 100560516Help
Entry
100560516         CDS       T01608                                 

Gene name
usp49
Definition
ubiquitin specific peptidase 49
Orthology
K11834  
ubiquitin carboxyl-terminal hydrolase 44/49 [EC:3.4.19.12]
Organism
acs  Anolis carolinensis (green anole)
Brite
Enzymes [BR:acs01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100560516 (usp49)
Peptidases [BR:acs01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100560516 (usp49)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
4
AA seq 697 aa AA seqDB search
MDRCKHVGRLRLAQDHSILNPQKWHCMDCNTTESIWACLKCSHVACGRYIEDHALKHFEE
TRHPLAMEVNDFYVFCYLCEDYVLNDNPEGDLKLLRSSLSAIKSQKHDPSARSGRTLRSM
ALGEDVCNHQRAPQGRPQMLTALWYRRQSLLAKALRTWFDKSSRGQQKLEQKRQMEELEI
KKEMARQRRQEMKRRLLEELASTPPRKSARLLSHIRRENLIPRKFRDMEASSPTSRRVQS
SRFKQFYSIRRKPLMTPGVTGLKNLGNTCYMNSILQVLSHLQKFRECFLTLDLCETEELL
AKTVNGKSRMSGKLVSGLGPTESGRNDQLGSYGRQSLPAGLNGGSSISKSLELTQPKEPS
SKHISLCHELHTLFRVMWSGKWASVSPFAMLHSVWSLIPAFRGYDQQDAQEFLCELLDKV
QQELESEGTKRRILIPFSQRKLTKQVLKVVNTIFHGQLLSQVTCITCNYKSNTVEPFWDL
SLEFPERYHSINKGIVPVNQTECMLTEMLAKFTETEALEGRIYACDQCNSKRRKSSPKPL
ILSEAKKQLMIYRLPQVLRLHLKRFRWSGRNHREKIGVHVLFDQVLNMEPYCCRDTLSSL
DKETFVYDLSAVVMHHGKGFGSGHYTAYCYNTEGGFWVHCNDSKLNVCSVEEVCKTQAYI
LFYTQRTVQGKASISETQLQAQVLSKHNDKDRRLTLP
NT seq 2094 nt NT seq  +upstreamnt  +downstreamnt
atggatagatgcaaacatgttgggcggctacgacttgcccaagaccactctattctgaac
ccccagaagtggcactgcatggactgcaacaccacagaatccatttgggcttgcctgaaa
tgctcccatgtggcctgtggaagatatattgaagaccatgcacttaaacactttgaagaa
accaggcatcctttggcaatggaagtaaatgatttctatgtcttctgttacctttgtgaa
gactatgtattgaatgataatcccgagggtgacttgaaattactaagaagttctctatcg
gcaattaaaagtcagaagcatgacccatctgctagaagtgggaggacgctgcggtcaatg
gctttgggggaggatgtttgcaaccatcagagggcccctcagggacggcctcagatgctt
acagccctttggtacagacggcaatcattgctagcaaaagcactgaggacctggtttgat
aagagttctagaggccaacaaaagctagaacaaaagagacaaatggaagaactagagatt
aaaaaagaaatggccaggcagcggcgtcaagagatgaaacggagattattggaggaactg
gcgagcacccctccaagaaaaagtgccaggcttttgtcacatattcgcagagagaatctg
attcctcgaaagttcagagacatggaagcaagttcccctacctcaagacgagtgcaaagt
agcagattcaaacagttttattccattcgtcggaagcctctcatgactcctggtgtgact
ggactaaagaatcttggaaatacctgctacatgaattctatccttcaagtattaagtcac
ctccagaagtttagagaatgttttttgacgctggatctctgtgaaactgaagaactctta
gctaagaccgtgaatggaaagtctagaatgtctggaaagctggtcagtgggcttggtcct
accgagtcagggaggaatgatcaattgggttcatatggcaggcagagcctgcctgctggc
ttgaatggcgggtcctcaataagcaaaagtttagaactaacacagcccaaggagccaagt
tcaaagcacatctctctctgtcatgaacttcacacacttttcagagttatgtggtctggg
aagtgggcttcagtgtctccttttgctatgctacactctgtatggagtctgattccagcg
tttcgaggttatgaccagcaagatgctcaggaatttctctgtgaattgttggacaaggtg
cagcaggagctggaatctgaaggaacaaaacgaaggatcctaatccccttttcacagagg
aagctcaccaagcaagtcctgaaagtggtgaacaccatttttcatgggcagctactcagt
caggttacctgtataacatgtaactataaatccaatactgtggaacccttctgggatctt
tccctggaattccctgaacgctatcactccatcaacaaagggattgtgcctgttaatcaa
acagagtgtatgcttactgaaatgctggccaaattcacagaaacagaagctttggaaggg
agaatttatgcatgtgaccagtgcaacagcaaacgacggaagtcttctcccaaacctctc
atactaagcgaagctaaaaagcagttaatgatctacagactacctcaggtcctccgactg
caccttaaacgattcaggtggtctggacgtaatcaccgtgagaagattggggtccatgtc
ctctttgaccaggtattaaacatggaaccttactgctgcagggacactctctcctctctt
gacaaagagacctttgtctatgacctctcggctgtggtgatgcatcatgggaaagggttt
ggctcaggacattacacggcttattgctacaacacggagggagggttttgggtccactgc
aatgactccaaactgaatgtatgtagtgtggaggaggtatgcaaaacccaggcctacatt
cttttttatactcaaagaaccgtgcagggcaaagcaagtatctcagaaacacaacttcaa
gctcaggtgctgtccaaacacaatgataaagacagaagattgacactcccatga

DBGET integrated database retrieval system