KEGG   Anolis carolinensis (green anole): 100560572Help
Entry
100560572         CDS       T01608                                 

Gene name
tmsb4x
Definition
thymosin beta 4, X-linked
Orthology
K05764  
thymosin, beta 4
Organism
acs  Anolis carolinensis (green anole)
Pathway
Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:acs00001]
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    100560572 (tmsb4x)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 44 aa AA seqDB search
MSDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
NT seq 135 nt NT seq  +upstreamnt  +downstreamnt
atgtctgacaaacccgatatggctgaaattgagaaattcgacaagtctaagttgaagaag
acagaaacgcaagagaaaaacccactaccttcaaaagaaacgattgaacaggagaaacaa
gcgggcgaatcgtaa

DBGET integrated database retrieval system