KEGG   Anolis carolinensis (green anole): 100560633Help
Entry
100560633         CDS       T01608                                 

Definition
ubiquitin carboxyl-terminal hydrolase 4-like
Orthology
K11835  
ubiquitin carboxyl-terminal hydrolase 4/11/15 [EC:3.1.2.15]
Organism
acs  Anolis carolinensis (green anole)
Brite
Enzymes [BR:acs01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     100560633
Peptidases [BR:acs01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100560633
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
2
AA seq 908 aa AA seqDB search
MAAAEAGFEGGGGGGSSGGATASPRPDAGTQRTELTPLLGAPLCPGESWYLIDSRWFKQW
KKYVGFDSWDLYNVGEPNLYPGPIDNSGLFADSETQTLKEHLIDELDYVLVPTEAWNKLV
NWYGCIEGQKPILRKVVEYGLFVKHCKVEVYLLELKLCQNNDSTNLVSSYFSKADTVATI
EKEMRKQFNIPDGKEIRLWSRYMSNTYEQLSKLDSTIQDAGLYQGQVVLIEVKNEDGSWP
RQSSQTKSSTATSRNLATSSKSSAGSCSSVVASSAITNGDSNNSYGLNSSHGKGGSSFSC
NFYNNRESSPQSQPGLCGLSNLGNTCFMNSALQCLSNTPPLTEYFLEDEYEAEINQENPL
GMRGEIAEAYAELIKQMWSGRYTHVAPRIFKVVAKEAWENHRLRNDSIIVDIFHGLFKST
LVCPKCSKVSVTFDPFCYLTLPLPMKKDRTMEVLFVFADPQRKPSQCRVVVPMMGGVTDL
CDALSQLSGIPAENMVVTDVYNHRFHKIFQMDEGLSNIMPKDNIFVYEISKPAEDGAECV
TLSIYFREKKARQSSATPATVLYGQPLLIAVPKHKLTLDYLYSVILERIGRYVKIPSKED
CPDVCSDNETCNGSNSVSEGEVEEMEHQNGEEENKEKILETDASQSEDGTQVESGKEGLH
HRKRLFTFSLVNSYGTSEINSLPTEGKILKLSSHATVAIDWDSDTRKLLFDEHEAQAFEK
HCSMFQPQKRKTAVALRDCIELFTTMETLGEHDPWYCPNCKKHQQATKKFDLWSLPRILV
VHLKRFSYNRYWRDKLDTVVEFPIRDLNMSEFVCDPAASPYVYDLIAVSNHYGGMGVGHY
TAYAKNKINGKWYYFDDSSVSPASEEQIVTKAAYVLFYQRRDDKLQRNPSPCTNTKMKSE
ECDGMDTN
NT seq 2727 nt NT seq  +upstreamnt  +downstreamnt
atggcggctgctgaagcggggttcgagggcggcggaggtggcggaagcagcggcggagcc
acggccagcccgaggccggacgcggggacgcagcggactgagctgacgccgcttttgggg
gcgccgctgtgcccgggggagtcctggtacctgattgacagccggtggttcaagcaatgg
aagaagtacgtgggctttgacagctgggacctgtataatgtgggagagcctaatctctac
cctggacctattgacaactcagggctttttgcagattcagaaacacagactttgaaagag
caccttattgatgaattggattatgtgttggttcctactgaagcttggaataaattagta
aattggtatggctgtatagagggacagaagccaattttgaggaaagttgtggagtatgga
ctgtttgtgaagcactgtaaagtagaggtttatcttttggagctgaagctatgtcaaaac
aacgactctactaatcttgtaagctcttatttcagcaaagcagatactgtggctaccatt
gaaaaagaaatgaggaaacagtttaatattcctgatggaaaagaaattagattgtggagc
agatatatgagtaatacttatgaacaactaagcaaactcgacagcactatacaagatgca
ggtctctatcagggacaggtagtattaatagaggtaaagaatgaagacggcagttggcca
agacaatcttcacagacaaaatcaagcactgcaacaagcagaaatctagctacctcttca
aaatcatcagcaggttcttgctcctcggtagttgcctcttcagccattacaaatggtgat
agcaataactcttatggtttgaactccagtcatggcaaaggaggctccagcttttcttgc
aacttctacaacaacagggagagctctccacagtcacagcctggcctctgtggtctcagt
aacctaggaaatacatgtttcatgaactcagccttacagtgtttgagtaacactccccca
ctgacagaatacttcttggaggatgaatatgaagctgaaataaatcaagaaaaccctcta
ggaatgagaggagaaattgcagaagcatatgcagaacttattaaacagatgtggtctgga
agatatactcatgtagccccccgcattttcaaagtggtggcaaaagaagcttgggagaat
catcggttacggaacgactccataattgtagatatttttcatggtctcttcaaatccaca
ttggtctgccccaaatgttctaaagtttcagtgacatttgaccctttttgctacttaact
cttccattgcccatgaaaaaagatcgaacgatggaggtgctgtttgtttttgcagatcca
caacgcaaaccatctcaatgccgagtagtggtgccaatgatggggggtgtaactgacctg
tgtgatgcactctcacaactctctggaattcctgcagaaaatatggtggtgacagatgtt
tataatcacagatttcacaaaattttccaaatggatgaaggcttgagtaatattatgcca
aaggacaacatatttgtatatgaaatttctaagcctgctgaagatggtgctgaatgcgtt
actctttcaatttacttcagagaaaagaaagcaagacaatccagtgctactccagctact
gtcctctatggccagccactactcatagctgtgcccaaacataagcttactctagattac
ttgtacagtgttatattggagaggattggccgctatgtaaaaattccttcaaaggaagac
tgtcctgatgtctgttcagataatgaaacttgcaatggctccaatagtgtgtctgaaggt
gaagttgaagagatggaacatcagaatggagaggaagaaaacaaggagaaaatattagaa
acagatgccagccagtctgaagatggcacccaggttgagtcaggaaaagaaggcctgcat
cacagaaagcggctcttcaccttcagtcttgtgaattcctatgggacttcagaaataaac
tcccttcccacagaggggaaaattctcaagttgagttcccatgctactgttgctattgac
tgggattctgacactcggaagttgctttttgatgaacatgaggcacaggcatttgaaaaa
cactgcagtatgtttcagccacagaagaggaaaactgctgtagcacttagagactgcata
gagctcttcacgactatggaaacacttggtgaacatgatccctggtactgtcctaattgc
aagaaacatcagcaagccacaaagaaatttgacctctggtctctgccacgcattttggta
gtacatttaaaacgtttttcatacaacagatactggagagacaaacttgacactgtggta
gaattccccatcagggatttgaacatgtctgagtttgtgtgtgacccagcagcaagtccc
tatgtatatgacctgattgctgtttccaatcactatggaggcatgggggttggtcactat
actgcatacgcaaagaataaaatcaatgggaaatggtattactttgatgatagcagtgtg
tcaccagcctctgaagagcaaatcgtgacaaaagcagcctatgtactattctaccaacgc
agagatgacaagctccagagaaacccatctccttgcacaaatactaagatgaaatcagaa
gaatgtgatggcatggatactaactga

DBGET integrated database retrieval system