KEGG   Anolis carolinensis (green anole): 100560646Help
Entry
100560646         CDS       T01608                                 

Gene name
acss2
Definition
acyl-CoA synthetase short-chain family member 2
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
acs  Anolis carolinensis (green anole)
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:acs00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    100560646 (acss2)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100560646 (acss2)
   00620 Pyruvate metabolism
    100560646 (acss2)
   00640 Propanoate metabolism
    100560646 (acss2)
Enzymes [BR:acs01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     100560646 (acss2)
Lipid biosynthesis proteins [BR:acs01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   100560646 (acss2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
4
AA seq 689 aa AA seqDB search
MVLPDEERGVGGGLLLFRAPAEQAREAHVPSLEKYRELYRRSVEEPQEFWSDIAKDFHWR
SQHNGPFLQYNFDVTKGKIFVEWMKGATTNICYNLLDRNVNEKKLGDKIAFYWEGNEPGD
SMKITYSELLSKVCQFANVLQEQGVKKGDRVSIYMPMIIELVVAMLACARIGAVHSIVFA
GFSAESLCERILDSHCSLLITADAFYRGDKLINLKQIADDALQKCRDKDHPLRRCIVVKH
IGREELVQDGPSSKSPPLKRLCQSVQVPWDPEVDVWWHDVIKNTSKECDPVWCDAEDELF
ILYTSGSTGKPKGVVHTIGGYMIFTAATFKYVFDYHPEDIYWCTADIGWITGHSYLTYGP
LANGATSVLFEGLPIYPDVGRMWNIIDKYKVTKFYTAPTAIRLLMKYGDEPVRKYSRKSL
KVLGTVGEPINPEAWLWYYKVVGEERCPIVDTFWQTETGGHVLTPLPFATPMKPGSATFP
FFGVVPAVLDESGEELEGEAEGYLVFKQPWPGIMRTVYKNHQRFETTYFKKFPGYYVTGD
GCKRDKDGYYWITGRIDDMLNVSGHLLSTAEVESALVEHSAISEAAVVSHPHPVKGECLY
CFVTLRDGHDFTKNLMDELKKQVREKIGPIATPDYIQNAPGLPKTRSGKIMRRVLRKIAK
NDRDLGDTSTVADPAVINHLFSNRCETIM
NT seq 2070 nt NT seq  +upstreamnt  +downstreamnt
atggtgcttcccgacgaggagcgcggcgttggcggcggcctgctcctcttccgagccccg
gcggagcaggcgcgggaggcgcacgtcccctccttggaaaagtaccgggagctttaccgc
cgctctgtggaggagccccaggaattttggagtgatattgccaaagactttcactggaga
agccaacacaatggaccgtttctgcagtataacttcgatgtcaccaaagggaaaatcttt
gttgaatggatgaaaggggctacaaccaacatctgctacaatctgttggatagaaatgtc
aatgagaaaaaacttggagacaaaatagcgttctactgggagggaaatgaaccaggcgat
tccatgaagatcacatacagcgagcttctcagtaaggtctgccagtttgctaatgttctt
caggaacaaggtgtgaagaaaggagacagagtttccatttacatgccaatgatcattgag
ctggtggtggccatgctggcatgtgccagaattggagcagttcattccattgtgtttgca
ggtttctcagcagagtccctttgtgagaggatccttgattcccactgctcccttcttatc
actgcagatgccttttatagaggcgataagctgattaacctgaagcaaatagcagatgat
gccttgcagaaatgtagagacaaggaccaccctttgcgaagatgcattgtggtcaagcat
ataggaagagaggaactggtacaagatgggccaagcagcaagtccccaccgctaaaaaga
ctctgccagagtgtgcaggtaccttgggatccggaagttgatgtttggtggcatgatgtt
attaaaaatactagcaaagagtgtgatcctgtctggtgtgatgcagaagatgaattattt
attctctacaccagtgggtcaactgggaaacccaagggtgttgtacatacgataggtgga
tatatgattttcactgctgctacctttaaatatgtgttcgattaccatccagaggacatt
tactggtgcacagctgacattggatggataactggccattcctatctcacatatgggcct
ttggcaaatggagcaaccagtgtcttatttgaaggacttcccatttacccagacgttggc
cggatgtggaacatcatcgacaaatacaaggtgaccaagttctacacagcacccactgcc
atccgacttcttatgaagtatggagatgaacctgtcaggaaatacagcaggaagtccttg
aaggtgttaggaacagtcggggagcccataaaccctgaagcctggctttggtactataaa
gtggttggtgaagagcgatgccctatcgtggataccttctggcagacagagacgggtggc
catgtgttgactccactcccttttgccacaccaatgaagccaggctcagctacatttccc
ttcttcggggtggttcctgcagtgctggatgagtctggagaggagctggaaggagaagcc
gaaggttacttggttttcaagcaaccttggccaggaataatgcgcacagtgtacaaaaac
caccagcggtttgaaactacttacttcaaaaagttccctggttactatgtgacaggagat
ggctgcaagagagataaagatggttattactggatcacaggtcgaattgatgacatgcta
aatgtttctggtcacttgctaagcacggcggaggtggagtctgccttggtggagcactct
gccatctcggaggcagctgtggtgagccacccacatccggtgaagggagagtgcctctac
tgctttgtaactctaagggatggtcatgatttcacgaagaatttgatggatgagctgaag
aaacaagttagagaaaaaattggacctattgcaactccagattatattcagaatgcccct
ggactgcccaaaacccgctcaggtaaaattatgcggcgagtattaagaaagatagcaaaa
aatgaccgggacctaggagatacctcaactgtggcagatccagctgttataaaccacctt
ttcagcaacaggtgtgagacaataatgtag

DBGET integrated database retrieval system