KEGG   Anolis carolinensis (green anole): 100560655Help
Entry
100560655         CDS       T01608                                 

Definition
cytochrome c
Orthology
K08738  
cytochrome c
Organism
acs  Anolis carolinensis (green anole)
Pathway
Sulfur metabolism
Metabolic pathways
p53 signaling pathway
Apoptosis
Herpes simplex infection
Brite
KEGG Orthology (KO) [BR:acs00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    100560655
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    100560655
   04115 p53 signaling pathway
    100560655
 Human Diseases
  Infectious diseases
   05168 Herpes simplex infection
    100560655
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
6
AA seq 105 aa AA seqDB search
MGDIEKGKKIFVQKCSQCHTVEKGGKHKTGPNLHGLFGRKTGQADGFSYTEANKSKGIIW
GEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKDSTSK
NT seq 318 nt NT seq  +upstreamnt  +downstreamnt
atgggagacattgagaagggcaagaagatatttgttcagaagtgttcacagtgccacaca
gttgagaagggtggcaaacacaagactggccccaatctacatggtctgtttggccggaag
actggacaagctgatggtttctcttatacagaagccaacaaaagcaaaggtataatctgg
ggtgaagatacattgatggaatacttggaaaaccccaagaagtatattccaggaaccaag
atgatctttgctggtattaagaagaagggggagagggcagatttaatagcataccttaag
gactccacttctaagtaa

DBGET integrated database retrieval system