KEGG   Anolis carolinensis (green anole): 100560655Help
Entry
100560655         CDS       T01608                                 

Definition
(RefSeq) cytochrome c
  KO
K08738  cytochrome c
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs01100  Metabolic pathways
acs04115  p53 signaling pathway
acs04210  Apoptosis
acs05168  Herpes simplex infection
Brite
KEGG Orthology (KO) [BR:acs00001]
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    100560655
   04115 p53 signaling pathway
    100560655
 Human Diseases
  Infectious diseases
   05168 Herpes simplex infection
    100560655
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550
Motif
Other DBs
NCBI-GeneID: 100560655
NCBI-ProteinID: XP_003222080
Position
6
AA seq 105 aa AA seqDB search
MGDIEKGKKIFVQKCSQCHTVEKGGKHKTGPNLHGLFGRKTGQADGFSYTEANKSKGIIW
GEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKDSTSK
NT seq 318 nt NT seq  +upstreamnt  +downstreamnt
atgggagacattgagaagggcaagaagatatttgttcagaagtgttcacagtgccacaca
gttgagaagggtggcaaacacaagactggccccaatctacatggtctgtttggccggaag
actggacaagctgatggtttctcttatacagaagccaacaaaagcaaaggtataatctgg
ggtgaagatacattgatggaatacttggaaaaccccaagaagtatattccaggaaccaag
atgatctttgctggtattaagaagaagggggagagggcagatttaatagcataccttaag
gactccacttctaagtaa

DBGET integrated database retrieval system