KEGG   Anolis carolinensis (green anole): 100560711Help
Entry
100560711         CDS       T01608                                 

Gene name
usp1
Definition
ubiquitin specific peptidase 1
Orthology
K11832  
ubiquitin carboxyl-terminal hydrolase 1 [EC:3.1.2.15]
Organism
acs  Anolis carolinensis (green anole)
Pathway
Fanconi anemia pathway
Class
Genetic Information Processing; Replication and repair; Fanconi anemia pathway [PATH:acs03460]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 777 aa AA seqDB search
MPGLLPSDSNGLPRGSPTKKGRLSLKFFQKRETKRALDFAEPPENEQKTSEYECSEIEQI
VPAAQPLSPVCCEKKDIMLPFVGLNNLGNTCYLNSILQVLYFCPGFKTGVKQLFNIISKK
KESLKDELDKGTIKEDSLAGYELVCSLHSLIISVEQLQASFLLSPDKYADELATQPRRLL
NTLRELNPMYEGYLQHDAQEVLQCILGHIQGTCQLLKEELKHKSLQAPTPKLRKKSSQNS
ESNGILEQDDNVLDDHVKKDCEDKNKGSVKRKSDIEGGNEKKKSRVSKEKNGGEENLRQT
RSKRKALEEKRENHPEAATDEMKIHIEIAKPSNKKSRLRLNWLKSSSNQPSILSKFCSLG
KLTTNLGLKDPIKEIENCEFPGMSVKCEKSNQPMEDSSPKESTAEKGTEKPFKKELADFD
LVERLFQGQLVLRTRCLECECFTERREDFQDISVPVQKDELSKVEDNSEISPEPKMEVKT
LKWAISQFASVERIVGEDKYFCENCHHYTEAERSLLFDKMPEVITIHLKCFAASGLEFDC
YGGLSKINTPLQTPLKLSLDDWSINPANEIYGLFAVVMHSGITISSGHYTASVKITDLDS
LELDKDNFILDALGKICPEPLNEQEARAVTEDYDDGEVSFRVGGNAQPNKGLNKKNTEAV
GLLGGQKSKSSCDLPINKASHSEKMANMTIEAKSAECSHAKQIVEFKHDEQAAAASNGVE
SKAIHIMQSLKEYEGKWLLFDDSEVKVTEEKDFLNLLSPISSSTSTPYLLFYKKIVA
NT seq 2334 nt NT seq  +upstreamnt  +downstreamnt
atgcccggcctgttgcccagtgacagtaatggacttcccagaggcagcccaacgaaaaaa
ggcaggctgtcgttgaagttttttcagaaaagggaaaccaaaagagcgctggactttgca
gagccaccagaaaatgagcaaaagacttcagaatatgagtgttctgaaattgagcagata
gttcctgcagcacagccactttcacctgtttgctgtgagaagaaagacatcatgttacct
tttgtgggcttgaacaatcttggcaacacttgctatcttaacagtatactccaggtgctg
tatttttgccctggctttaaaactggagtgaaacaattattcaacataatttccaaaaag
aaggaaagcttaaaggatgaactagataaggggacaattaaagaagattctcttgcaggc
tatgaattggtctgcagtttacactccctgatcatttcagttgaacagcttcaggccagc
ttcctcttaagtccagataaatatgcagatgaacttgctacgcaaccaagaagactccta
aacacactaagggaactcaatcccatgtatgagggatatttgcagcatgatgcccaagaa
gttttgcagtgtatattggggcatatccaaggaacatgccagctcttaaaggaggaactc
aaacataaatcattgcaagcacccacacctaaacttagaaaaaaatccagtcagaatagt
gaaagtaatggtattcttgaacaagatgataatgtgcttgatgatcatgtgaaaaaggac
tgtgaagataaaaataaaggtagtgtgaaaagaaagagtgatattgaaggaggcaatgaa
aagaaaaaatccagagtatccaaggagaaaaatggaggcgaagaaaatctaagacagact
cggtcaaagagaaaagcactagaagagaaacgggaaaatcatcctgaagctgccactgat
gaaatgaaaatacacattgaaattgctaagccaagcaataaaaaatcaaggcttaggtta
aactggttaaaatcttcaagcaaccagcctagtattttgtctaaattctgtagtcttgga
aaactaacaacaaacttagggttgaaagatcctatcaaagaaattgagaactgtgaattt
ccaggcatgtctgtcaagtgtgaaaaaagtaaccaaccaatggaagattcatctcccaag
gaaagcactgctgaaaaaggaactgaaaaaccattcaagaaagagttagctgactttgat
ttagtagaaagactctttcagggtcagttggtgttgagaacaagatgtttagaatgtgaa
tgcttcactgagaggagagaagactttcaagatatcagtgtgccagtacaaaaagatgaa
ctgtccaaagtggaagataattctgaaatttcaccagagcccaaaatggaagtgaaaacg
ctgaagtgggcaatttcacagttcgcttctgtggagaggattgtgggagaagataaatat
ttctgtgaaaattgtcatcattatacagaagccgagcggagtcttctttttgataaaatg
cctgaagttataacaatccatttgaagtgctttgctgctagcggattagagtttgactgt
tacggtggactctccaagataaatacacctttacagactcctctcaagctgtccttagac
gactggagcataaacccagccaatgaaatctatggattatttgccgttgtgatgcacagt
ggcattaccatcagcagtgggcactatacagcctctgttaaaattacagatcttgacagc
ttagaattagacaaggataatttcatccttgatgctcttggtaaaatttgcccagagcca
ctgaatgaacaagaagcaagagctgtcacagaggactatgatgatggtgaggtctccttc
agagttggtggaaatgcacaacctaataaaggtttgaacaaaaagaatacagaagctgtg
gggcttctcggaggacaaaagagtaaatccagttgtgatttgcccattaacaaagcgagc
cattctgagaagatggctaacatgaccattgaggctaaaagtgctgaatgtagccatgct
aaacaaatcgtggagtttaaacatgatgagcaagctgctgctgcctctaatggagtagaa
agcaaagctattcatattatgcagagcctcaaagagtatgagggaaagtggctccttttt
gatgattctgaagtgaaagttacagaggaaaaggactttcttaaccttttgtcccctatt
tcatcatctacatccactccctacctgctgttttataagaaaattgtagcgtga

DBGET integrated database retrieval system