KEGG   Anolis carolinensis (green anole): 100560758Help
Entry
100560758         CDS       T01608                                 

Gene name
plcb4
Definition
phospholipase C, beta 4
Orthology
K05858  
phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
acs  Anolis carolinensis (green anole)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Calcium signaling pathway
Phosphatidylinositol signaling system
Adrenergic signaling in cardiomyocytes
Vascular smooth muscle contraction
Wnt signaling pathway
Gap junction
GnRH signaling pathway
Melanogenesis
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Class
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:acs00562]
Environmental Information Processing; Signal transduction; Wnt signaling pathway [PATH:acs04310]
Environmental Information Processing; Signal transduction; Calcium signaling pathway [PATH:acs04020]
Environmental Information Processing; Signal transduction; Phosphatidylinositol signaling system [PATH:acs04070]
Cellular Processes; Cell communication; Gap junction [PATH:acs04540]
Organismal Systems; Endocrine system; GnRH signaling pathway [PATH:acs04912]
Organismal Systems; Endocrine system; Melanogenesis [PATH:acs04916]
Organismal Systems; Circulatory system; Adrenergic signaling in cardiomyocytes [PATH:acs04261]
Organismal Systems; Circulatory system; Vascular smooth muscle contraction [PATH:acs04270]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1
AA seq 1187 aa AA seqDB search
MAKPYEFNWQKPVPSFLQDGAVFDRYEEESSVFEPSCLFKVDEFGFFLTWKSDGKEGQVL
ECSLINSIRFGAVPKDPKILAALEAVGKAENELEGRIVCVCSGTDLVNINFTYMVAENNE
EAKQWVEGLRSIIHNFRANNVCPMTCLKKHWMKLAFLTNTNGKIPVRSITRTFASGKTEK
VIFQALKELGLPSGKNDEIEPSAFTYEKFYELTQKICPRTDIEDLFRKINGDKTDYLTVD
QLVSFLNEHQRDPRLNEILFPFYDPKRAMQIVETYEPDEDLKSKGLMSSDGFCRYLMSDE
NAPVFLDRLELYQEMEHPLAHYFISSSHNTYLTGRQFGGKSSVEMYRQVLLAGCRCVELD
CWDGKGEDQEPIITHGKAMCTDILFKDVIQAIRETAFVTSDYPVILSFENHCSKYQQYKM
SKYCEDIFGDLLLKQPLEGYPLESGRPLPSPNDLKRKILIKNKRLKPEVEKKQLENLKSM
MEAGETAAPVSILEDDNEEEIESADQEEEAHPEYKFGSELSADDLSQKEVVANHVKKAVD
DSEQENNKKGVITAEDEQAWMASYKYVGATTNIHPYLSALINYAQPVKFQGFHVAEERNI
HYNMSSFNESVGLGYLKTHAIEFVNYNKRQMSRIYPKGGRVDSSNYMPQIFWNAGCQMVS
LNYQTPDLAMQLNQGKFEYNGSCGFLLKPDFMRRPDRTFDPFSETPVDGVIAATCSVQVI
SGQFLSDKKIGTYVEVDMYGLPTDTIRKEFRTRMVMNNGLNPVYNEESFVFRKVILPDLA
VLRIAVYDDNNKLIGQRILPLDGLQAGYRHISLRNEGNKPLSLPTIFCNIVLKTYVPDGF
GDIVDALSDPKKFLSVMEKRADQMRAMGIETSDIADVPNDTSKNEKKGKANNPKANVTPQ
TSAELRPNATSSVGPAVEPKKGIDLIPQIKIEDLKQMKAYIKHLKKQQKELNALKKRHVK
EHSVMQKLHCTQVDKMVAQYDKEKLGYEKILEKAIKKKGGNNCLEVKKEIENKIQMLTSD
HKSKVKEIVAQHTKEWSEMINTHSAEEQEMRDLHLSQQCELLKKLLVNAHEQQTQQLKLS
HDRESKEMRANQAKISMENSKAISQDKSIKNKAERERRVRELNSSNTKKFLEERKRLAMK
QSKEMDQLKKVQLEHLEILEKQNEQAKEMQQMVKLEAEMDRRPATVV
NT seq 3564 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaaccatatgaatttaactggcagaagccagttccatcctttctacaagatgga
gctgttttcgacagatatgaagaagaatcttctgtctttgaaccaagctgcctcttcaaa
gtggatgagtttggcttttttctaacatggaaaagtgatggaaaggaagggcaagtttta
gaatgctccctaatcaacagtattcgttttggagctgtaccaaaggatccaaagatactg
gctgctcttgaagctgttggcaaagcagaaaatgaactggaaggacgaatagtttgcgtc
tgtagtggcacagatctggtgaatatcaacttcacatacatggtagcagaaaacaatgaa
gaagctaagcaatgggttgaaggactccgatcaatcatacataactttagagcaaacaat
gtctgtcccatgacatgtctcaagaaacactggatgaaactggcatttctaaccaacaca
aatggcaagattccagttagaagcattaccagaacgtttgcatcagggaaaactgaaaag
gtgatcttccaggcacttaaggaattgggtcttcccagcggaaagaatgatgaaatagag
ccttcagcttttacttatgagaagttttatgagctaactcagaagatatgtcctcgtact
gatatagaggatctttttaggaaaatcaatggagacaaaactgattatttaacggtagac
caattagtgagctttctaaatgaacaccaacgagatcctcgactgaacgaaattttattt
ccattctatgatcccaaaagagcaatgcagatagtggagacatatgagccagatgaagat
ttaaagagcaagggtctcatgtcgagtgatggattctgtcgatacttgatgtcagatgag
aatgcacctgtcttcctggatcgcttagagctataccaagaaatggaacatcctttggct
cattattttattagctcatcccacaacacgtatctcacaggaagacagtttggtgggaag
tcatctgtggagatgtatagacaagtcctcttagctggatgcagatgtgttgaacttgat
tgctgggatggaaaaggtgaggaccaagaaccaataataacacatggaaaggctatgtgt
acggacatacttttcaaggacgtgattcaagctattcgggaaacagcatttgtaacatct
gactatcctgtcatcctgtcatttgaaaaccactgcagcaaatatcaacaatacaaaatg
tcaaaatattgtgaagacatttttggagaccttctgctgaagcaaccattagaaggatat
ccacttgaatcaggaagacccttgccttccccaaatgacctgaaaagaaagattcttatt
aaaaataagaggttgaaaccggaagtggagaaaaaacagctagaaaatttgaaaagtatg
atggaagctggtgaaactgccgctcctgtcagcatcttagaagatgataatgaagaagaa
atagaaagtgctgaccaggaagaggaagcccatccagagtacaagtttggaagtgagctc
tccgctgatgacttgagccaaaaagaagtggtggccaatcatgtgaaaaaggctgtggac
gattctgaacaagaaaacaataaaaagggagtaataactgcagaggatgagcaagcatgg
atggcttcttacaaatatgtaggtgccacaactaatatacatccatacttatcagcgttg
atcaactatgcccaacctgttaaatttcaaggtttccatgtagcagaagaacgcaacatt
cactacaacatgtcttcttttaatgagtcggttggtctaggctatttgaaaacacacgca
attgagttcgtgaactataataaacgtcaaatgagccggatttacccaaagggaggcaga
gtggattccagcaattatatgcctcaaattttctggaacgctgggtgccagatggtctct
ctcaactatcagactccagatttagcaatgcagttgaatcagggaaaatttgaatataat
gggtcatgcgggtttcttcttaaaccagattttatgaggagacctgatcggacatttgat
cctttctctgaaactcctgtagatggtgtaattgcagcaacttgttcagtacaggtaata
tctggacagttcttatcagacaaaaaaattggtacttacgtagaagtggatatgtatggc
cttcccaccgacactatacgtaaagaattccgaacacggatggtgatgaacaatggtttg
aatcctgtttacaatgaagaatcatttgtattccgaaaggttattctaccagatcttgcg
gttttgagaatagccgtttatgatgacaacaacaaactgattggccaaaggatattacct
ctagatggtcttcaggcaggttatagacacatttctcttcgaaatgaaggcaacaaacca
ttatctctgccaacaatcttctgcaacattgtactcaaaacatatgtaccagatgggttt
ggagacattgtggatgctttgtcagatcccaagaaatttttatctgtcatggagaaaaga
gcagaccagatgagagctatggggattgaaacaagtgatatagctgatgttccaaatgac
acatcaaagaatgaaaagaaaggcaaagctaataatcccaaagcaaatgttactcctcag
actagcgctgaacttagaccaaatgccacatcaagtgtggggccagcagtggaacctaag
aaaggtatagatcttattcctcaaataaagatagaagatctgaagcaaatgaaggcatat
ataaagcatttgaaaaaacagcaaaaagagttgaatgctttgaagaagagacatgtaaag
gaacacagtgtcatgcaaaagttgcactgcacacaagttgacaaaatggtagcgcagtat
gacaaagagaagttagggtatgagaaaatccttgaaaaagcaatcaagaaaaaaggaggg
aataattgccttgaggtgaaaaaagaaatagaaaataaaatacagatgctaacatctgat
cacaaatcaaaggtaaaagaaattgtggcacagcacacgaaagagtggtcagagatgatc
aatacacatagtgccgaagagcaagaaatgcgtgatttgcatctgagccagcagtgcgag
ttactaaaaaagctgctagttaatgcgcacgaacagcagacccagcaactaaagctttcc
catgacagagaaagcaaagaaatgcgtgccaatcaagccaaaatttcaatggaaaacagt
aaagccattagccaagacaaatccatcaaaaacaaagccgaaagagagaggcgtgtcaga
gaactgaacagcagcaacacaaagaagtttttggaagaaagaaagcggttggcaatgaag
caatcaaaggaaatggatcagctaaagaaagttcaacttgaacatctagaaattctggag
aagcaaaatgagcaggcaaaggagatgcagcagatggtgaagctcgaagcagagatggac
cgcaggccagcaacagtggtataa

DBGET integrated database retrieval system