KEGG   Anolis carolinensis (green anole): 100560802Help
Entry
100560802         CDS       T01608                                 

Gene name
nlk
Definition
nemo-like kinase
Orthology
K04468  
nemo like kinase [EC:2.7.11.24]
Organism
acs  Anolis carolinensis (green anole)
Pathway
MAPK signaling pathway
FoxO signaling pathway
Wnt signaling pathway
Adherens junction
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:acs04010]
Environmental Information Processing; Signal transduction; Wnt signaling pathway [PATH:acs04310]
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:acs04068]
Cellular Processes; Cell communication; Adherens junction [PATH:acs04520]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 527 aa AA seqDB search
MSLCSATAGAKMMAAYNGGTSAAAAGHHHHHHHHLAHLPPPHLHHHHHPQHHLHPGSAAA
VHPVQQHASSAAAAAAAAAAAAAMLNPGQQQPYFPSPAPGQAPGPAAAAPAQVQAAAAAA
VKAHHHQHTHHPQQQLDIEPDRPIGYGAFGVVWSVTDPRDGKRVALKKMPNVFQNLVSCK
RVFRELKMLCFFKHDNVLSALDILQPPHIDYFEEIYVVTELMQSDLHKIIVSPQPLSSDH
VKVFLYQILRGLKYLHSAGILHRDIKPGNLLVNSNCVLKICDFGLARVEELDESRHMTQE
VVTQYYRAPEILMGSRHYSNAIDIWSVGCIFAELLGRRILFQAQSPIQQLDLITDLLGTP
SLEAMRTACEGAKAHILRGPHKQPSLPVLYTLSSQATHEAVHLLCRMLVFDPSKRISAKD
ALAHPYLDEGRLRYHTCMCKCCFSTSTGRVYTNDFEPITNPKFDDTFEKNLSSVRQVKEI
IHQFILEQQKGSRVPLCINPQSAAFKSFISSTVAQPSEMPPSPLVWE
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atgtctctgtgtagtgccacagccggcgcaaaaatgatggcggcttacaatggcggtaca
tccgccgccgctgcaggtcaccaccaccaccatcaccaccaccttgcccacctccctcct
cctcatctccatcaccaccatcatccccagcaccacttgcacccaggctctgcggctgca
gtgcatcctgtgcagcaacatgcttcttcggcggctgcagcggcggcggctgcggcggca
gctgcagccatgttaaatccaggccagcagcagccatatttcccgtcaccggcaccaggt
caggctcctgggccagctgcagctgccccagctcaggtacaagctgcagcagcggctgca
gttaaagcgcatcatcatcagcacacacatcacccgcagcagcaactggatatcgagcca
gatcggcctattggatatggagcctttggtgtcgtctggtcagtcacagatccacgcgat
ggaaagagagttgcactcaaaaagatgcccaacgtcttccaaaatctggtctcttgcaaa
agggtcttccgcgaattgaagatgttgtgtttttttaagcatgacaatgtactctctgct
cttgacattcttcagccaccacacattgactactttgaagaaatatatgttgttacagaa
ttgatgcagagtgaccttcataagattatcgtctctcctcaaccactcagttcagatcat
gtcaaagtttttctttaccagattttgagaggtctgaaatacctacattctgctggtatt
ttgcatcgagacattaaaccagggaatctgcttgtgaacagcaactgtgttcttaagatc
tgtgattttggcttggcgcgggtggaagagttagacgaatcgcgtcacatgactcaggaa
gtcgtcactcagtattaccgagctcccgaaatcctgatgggcagccgccactacagcaat
gctattgatatttggtctgtgggctgtatatttgctgaattactagggcggcgaatactg
tttcaagctcagagtcccattcagcagttggatttgatcacagatcttctgggaacaccg
tcactggaagcaatgaggacggcttgtgaaggcgccaaggcacacatactcaggggtcct
cataaacagccatcccttcctgtcctgtatacattatcaagtcaagctacacatgaagcc
gttcatctcctttgtaggatgttggtctttgatccatccaagcgaatatctgctaaggat
gccttagctcatccatatctggacgaagggcgtttgcgataccacacctgcatgtgtaaa
tgttgcttctccacctcgacgggacgcgtttacaccaacgatttcgaacctatcacgaac
cccaagttcgacgatacgtttgaaaagaacctcagttctgttcggcaggtgaaagaaatt
attcatcagttcattttggaacagcagaaaggaagcagagtaccgctgtgcatcaaccca
caatctgctgcttttaagagctttattagttccactgttgcccagccgtccgagatgccg
ccgtctccactggtctgggagtaa

DBGET integrated database retrieval system