KEGG   Anolis carolinensis (green anole): 100560802Help
Entry
100560802         CDS       T01608                                 

Gene name
nlk
Definition
(RefSeq) nemo like kinase
  KO
K04468  
nemo like kinase [EC:2.7.11.24]
Organism
acs  Anolis carolinensis (green anole)
Pathway
MAPK signaling pathway
FoxO signaling pathway
Wnt signaling pathway
Adherens junction
Brite
KEGG Orthology (KO) [BR:acs00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100560802 (nlk)
   04310 Wnt signaling pathway
    100560802 (nlk)
   04068 FoxO signaling pathway
    100560802 (nlk)
 Cellular Processes
  Cellular community - eukaryotes
   04520 Adherens junction
    100560802 (nlk)
Enzymes [BR:acs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     100560802 (nlk)
Protein kinases [BR:acs01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   100560802 (nlk)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
Position
Un
AA seq 527 aa AA seqDB search
MSLCSATAGAKMMAAYNGGTSAAAAGHHHHHHHHLAHLPPPHLHHHHHPQHHLHPGSAAA
VHPVQQHASSAAAAAAAAAAAAAMLNPGQQQPYFPSPAPGQAPGPAAAAPAQVQAAAAAA
VKAHHHQHTHHPQQQLDIEPDRPIGYGAFGVVWSVTDPRDGKRVALKKMPNVFQNLVSCK
RVFRELKMLCFFKHDNVLSALDILQPPHIDYFEEIYVVTELMQSDLHKIIVSPQPLSSDH
VKVFLYQILRGLKYLHSAGILHRDIKPGNLLVNSNCVLKICDFGLARVEELDESRHMTQE
VVTQYYRAPEILMGSRHYSNAIDIWSVGCIFAELLGRRILFQAQSPIQQLDLITDLLGTP
SLEAMRTACEGAKAHILRGPHKQPSLPVLYTLSSQATHEAVHLLCRMLVFDPSKRISAKD
ALAHPYLDEGRLRYHTCMCKCCFSTSTGRVYTNDFEPITNPKFDDTFEKNLSSVRQVKEI
IHQFILEQQKGSRVPLCINPQSAAFKSFISSTVAQPSEMPPSPLVWE
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atgtctctgtgtagtgccacagccggcgcaaaaatgatggcggcttacaatggcggtaca
tccgccgccgctgcaggtcaccaccaccaccatcaccaccaccttgcccacctccctcct
cctcatctccatcaccaccatcatccccagcaccacttgcacccaggctctgcggctgca
gtgcatcctgtgcagcaacatgcttcttcggcggctgcagcggcggcggctgcggcggca
gctgcagccatgttaaatccaggccagcagcagccatatttcccgtcaccggcaccaggt
caggctcctgggccagctgcagctgccccagctcaggtacaagctgcagcagcggctgca
gttaaagcgcatcatcatcagcacacacatcacccgcagcagcaactggatatcgagcca
gatcggcctattggatatggagcctttggtgtcgtctggtcagtcacagatccacgcgat
ggaaagagagttgcactcaaaaagatgcccaacgtcttccaaaatctggtctcttgcaaa
agggtcttccgcgaattgaagatgttgtgtttttttaagcatgacaatgtactctctgct
cttgacattcttcagccaccacacattgactactttgaagaaatatatgttgttacagaa
ttgatgcagagtgaccttcataagattatcgtctctcctcaaccactcagttcagatcat
gtcaaagtttttctttaccagattttgagaggtctgaaatacctacattctgctggtatt
ttgcatcgagacattaaaccagggaatctgcttgtgaacagcaactgtgttcttaagatc
tgtgattttggcttggcgcgggtggaagagttagacgaatcgcgtcacatgactcaggaa
gtcgtcactcagtattaccgagctcccgaaatcctgatgggcagccgccactacagcaat
gctattgatatttggtctgtgggctgtatatttgctgaattactagggcggcgaatactg
tttcaagctcagagtcccattcagcagttggatttgatcacagatcttctgggaacaccg
tcactggaagcaatgaggacggcttgtgaaggcgccaaggcacacatactcaggggtcct
cataaacagccatcccttcctgtcctgtatacattatcaagtcaagctacacatgaagcc
gttcatctcctttgtaggatgttggtctttgatccatccaagcgaatatctgctaaggat
gccttagctcatccatatctggacgaagggcgtttgcgataccacacctgcatgtgtaaa
tgttgcttctccacctcgacgggacgcgtttacaccaacgatttcgaacctatcacgaac
cccaagttcgacgatacgtttgaaaagaacctcagttctgttcggcaggtgaaagaaatt
attcatcagttcattttggaacagcagaaaggaagcagagtaccgctgtgcatcaaccca
caatctgctgcttttaagagctttattagttccactgttgcccagccgtccgagatgccg
ccgtctccactggtctgggagtaa

DBGET integrated database retrieval system