KEGG   Anolis carolinensis (green anole): 100560832Help
Entry
100560832         CDS       T01608                                 

Definition
profilin-2-like
Orthology
K05759  
profilin
Organism
acs  Anolis carolinensis (green anole)
Pathway
Regulation of actin cytoskeleton
Salmonella infection
Class
Cellular Processes; Cell motility; Regulation of actin cytoskeleton [PATH:acs04810]
Human Diseases; Infectious diseases; Salmonella infection [PATH:acs05132]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 140 aa AA seqDB search
MAGWQSYVDNLMCDGCCQEAAIVGYCDAKYVWAATAGGIFQSITPLEIDMIVGKDREGFF
TNGLTLGAKKCSVIRDSLYVDGDCTMDIRTKSQGGEPTYNVAVGRAGRVLVFVMGKEGVH
GGGLNKKAYSMAKYLRDSGF
NT seq 423 nt NT seq  +upstreamnt  +downstreamnt
atggcaggctggcagagctacgtggataacctgatgtgcgatggctgctgccaggaggcc
gccattgtcggctactgtgacgccaaatacgtctgggccgccactgccggcggcatcttc
cagagcattacgcctctagaaatagatatgattgtaggaaaagaccgcgagggtttcttc
accaatggtctaactcttggtgcaaagaagtgctctgtgatcagagatagcctctatgtg
gatggtgactgtacaatggacatcaggacaaagagccaaggaggcgagccaacatataat
gttgctgtaggcagagctggtcgagtcttggtctttgtaatgggcaaagaaggggtccat
ggaggcggattgaataagaaggcatactcaatggcaaaatacttgagagactctgggttc
tag

DBGET integrated database retrieval system