KEGG   Anolis carolinensis (green anole): 100560832Help
Entry
100560832         CDS       T01608                                 

Definition
profilin-2-like
Orthology
K05759  
profilin
Organism
acs  Anolis carolinensis (green anole)
Pathway
Regulation of actin cytoskeleton
Salmonella infection
Brite
KEGG Orthology (KO) [BR:acs00001]
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    100560832
 Human Diseases
  Infectious diseases
   05132 Salmonella infection
    100560832
Exosome [BR:acs04147]
 Exosomal proteins
  Proteins found in most exosomes
   100560832
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 140 aa AA seqDB search
MAGWQSYVDNLMCDGCCQEAAIVGYCDAKYVWAATAGGIFQSITPLEIDMIVGKDREGFF
TNGLTLGAKKCSVIRDSLYVDGDCTMDIRTKSQGGEPTYNVAVGRAGRVLVFVMGKEGVH
GGGLNKKAYSMAKYLRDSGF
NT seq 423 nt NT seq  +upstreamnt  +downstreamnt
atggcaggctggcagagctacgtggataacctgatgtgcgatggctgctgccaggaggcc
gccattgtcggctactgtgacgccaaatacgtctgggccgccactgccggcggcatcttc
cagagcattacgcctctagaaatagatatgattgtaggaaaagaccgcgagggtttcttc
accaatggtctaactcttggtgcaaagaagtgctctgtgatcagagatagcctctatgtg
gatggtgactgtacaatggacatcaggacaaagagccaaggaggcgagccaacatataat
gttgctgtaggcagagctggtcgagtcttggtctttgtaatgggcaaagaaggggtccat
ggaggcggattgaataagaaggcatactcaatggcaaaatacttgagagactctgggttc
tag

DBGET integrated database retrieval system