KEGG   Anolis carolinensis (green anole): 100560889Help
Entry
100560889         CDS       T01608                                 

Gene name
alad
Definition
aminolevulinate dehydratase
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
acs  Anolis carolinensis (green anole)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:acs00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    100560889 (alad)
Enzymes [BR:acs01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     100560889 (alad)
Exosome [BR:acs04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100560889 (alad)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 330 aa AA seqDB search
MESLLQSGYFHPVLRSWQASASAFQASQLIYPVFVTDNPDAVEPIASLPGQARHGVNRLE
ELLRPLVADGLKCILMFGVPSKAIKDECGSAADGEETPVIQAVRRVRSLFPELLIACDVC
LCPYTSHGHCGILRTDGSLQNEASCHRLAEVALAYAKAGCHIVAPSDMMDGRIRAIKEAL
ISNDLGNKVSVMSYSAKFASCFYGPFRDAALSKPAFGDRRCYQLPPGSRGLALRAVDRDV
KEGADLLMVKPGMPYLDLVREVKDRHPNHPLAIYHVSGEFAMLWHGAQAGAFDLKAVVME
ALAGFRRAGADVLITYFVPQLLQWMKEDRA
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atggagtccctcctgcagagcggctacttccacccggtgctccgctcctggcaggcctcc
gcctccgccttccaggcctcccagctcatctacccggtctttgtcacggacaacccagat
gcagtggagcccattgccagcctccctggccaggctcggcacggggtcaaccgtctggag
gagctgctgcgccccttggttgccgacgggctgaagtgcatcctgatgtttggggtcccc
agcaaagccatcaaggacgagtgcggctctgcggccgacggcgaggagacccccgtgatc
caggccgtacgaagggtccgctccttgttcccggagctgctcattgcctgcgacgtctgc
ctgtgcccctacacctcccacggccactgcgggatcctgcggactgatggctccctccag
aacgaggccagttgccacaggttggcggaggtggccctggcctacgccaaggcagggtgt
cacatcgtggctccttcggacatgatggacgggcgcatccgggccatcaaggaggcctta
atctccaacgacctgggcaacaaggtctcagtcatgagctacagcgccaagtttgcctcc
tgcttctacggccctttccgggacgcagccctgtccaagcctgcttttggagaccggcgg
tgttaccagctccccccaggatcccgtgggctggctctgcgggcagtggaccgggatgtg
aaggagggagccgacctgctgatggtcaagcctggcatgccctacctggacctggtgcgg
gaggtcaaggacagacaccccaaccacccgctggccatctaccacgtctctggggagttt
gccatgctgtggcacggggcgcaggccggggcctttgacctgaaggccgtggtgatggag
gccttggccggattcaggcgagcaggggccgacgttctcatcacgtacttcgtgccacaa
ctgctgcaatggatgaaggaggaccgagcctga

DBGET integrated database retrieval system