KEGG   Anolis carolinensis (green anole): 100560978Help
Entry
100560978         CDS       T01608                                 

Gene name
pdk4
Definition
pyruvate dehydrogenase kinase, isozyme 4
Orthology
K00898  
pyruvate dehydrogenase kinase 2/3/4 [EC:2.7.11.2]
Organism
acs  Anolis carolinensis (green anole)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
6
AA seq 420 aa AA seqDB search
MKAARIALRNAGPLATTSHGLPSSGRATREVEHFARYSPSPLSIKQFLDFGSTNACERTS
FSFLRHELPVRLANILKEIDLLPSPLLSTPSVQLVKSWYVQSLMELVEFHDKKSDDHKVL
SDFIDAIIKVRNRHHDVVPTMAQGVLEYRDSSKMDPFINQNIQYFLDRFYMNRISIRMLI
NQHTLIFDNNNSIGNPRHIGCIDPCCDVVDLVHDAFQSAQMLCDQYYFASPELKLTQVNG
KTAGQPIHIVYVPSHLFHMLFELFKNAMRATVEHQESKPSLDPVEVTVVLGKEDLSIKIS
DRGGGVPVRKIESLFSYTYSTAPKPVMDNNNTTPLAGFGYGLPISRLYAKYFHGDINLCS
ISGYGTDALIYLKALSTESIEKLPVFNKSACKHYQTPIEADDWCVPSKEPKNLSRQSAAA
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atgaaggctgctcggatcgccctacggaacgcgggccctttggccaccacgagccatggc
ctccctagcagcgggagggccacccgggaagtggagcattttgctcgttactcgccttcg
cccctgtccatcaagcagttcctggatttcgggtcaactaatgcttgtgaaagaacctct
ttttcatttcttcggcatgaacttcctgtgcggctagcaaatattctgaaagaaattgac
ctccttcctagtccattgttgagcactccttcagtacagttagtaaaaagctggtatgtc
caaagcctaatggaactggtggagttccatgataaaaaatctgatgaccacaaagttcta
tcagattttatagatgccattattaaagtcagaaaccgacatcatgatgtggtgcccaca
atggcccagggagttctagaatacagagattcatcaaagatggatccattcatcaatcaa
aacattcagtacttcttggatcgattttacatgaaccggatatccattcgaatgctaata
aaccaacacacacttatttttgacaacaataatagtatcggtaatccaaggcacattgga
tgcattgacccatgctgtgatgttgttgacctggtgcatgatgctttccaaagtgcccag
atgctttgtgaccagtattactttgcttctccagagttaaagctcactcaagtgaatgga
aagacagctggacagcctattcacatagtatatgtaccttctcatctctttcacatgctg
tttgaactcttcaagaatgcaatgagagcaacagttgaacatcaagaaagcaagccctcc
cttgatccagtagaagtgactgttgtacttggaaaggaagacctgtcaattaagatatct
gatagaggaggtggtgtgccagtgaggaaaattgaaagcctcttcagctacacatattct
actgcaccaaagcctgtaatggataacaacaatacaactcctttggctggtttcggatat
ggattgccaatttctcgcctgtatgctaaatactttcatggagacatcaatctttgttcc
atttctggctatgggacagatgctttgatttacttaaaggctctttccacagaatctata
gaaaagcttcctgttttcaacaaatcagcctgcaagcattatcaaactcctatagaagca
gatgactggtgtgttccaagtaaagaaccaaaaaatctgtcacgacagagtgcagctgca
tga

DBGET integrated database retrieval system