KEGG   Anolis carolinensis (green anole): 100560978Help
Entry
100560978         CDS       T01608                                 

Gene name
pdk4
Definition
pyruvate dehydrogenase kinase, isozyme 4
Orthology
K00898  
pyruvate dehydrogenase kinase 2/3/4 [EC:2.7.11.2]
Organism
acs  Anolis carolinensis (green anole)
Brite
Enzymes [BR:acs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.2  [pyruvate dehydrogenase (acetyl-transferring)] kinase
     100560978 (pdk4)
Protein kinases [BR:acs01001]
 Serine/threonine protein kinases: Atypical group
  PDHK family [OT]
   100560978 (pdk4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
6
AA seq 492 aa AA seqDB search
MPPCCRHLFDRFKGRDYWGEPGGVAQLWPRPLGDINKGCTCRGKSEGIESSSSEIVWGRQ
QGTPGSSSTSVAMKAARIALRNAGPLATTSHGLPSSGRATREVEHFARYSPSPLSIKQFL
DFGSTNACERTSFSFLRHELPVRLANILKEIDLLPSPLLSTPSVQLVKSWYVQSLMELVE
FHDKKSDDHKVLSDFIDAIIKVRNRHHDVVPTMAQGVLEYRDSSKMDPFINQNIQYFLDR
FYMNRISIRMLINQHTLIFDNNNSIGNPRHIGCIDPCCDVVDLVHDAFQSAQMLCDQYYF
ASPELKLTQVNGKTAGQPIHIVYVPSHLFHMLFELFKNAMRATVEHQESKPSLDPVEVTV
VLGKEDLSIKISDRGGGVPVRKIESLFSYTYSTAPKPVMDNNNTTPLAGFGYGLPISRLY
AKYFHGDINLCSISGYGTDALIYLKALSTESIEKLPVFNKSACKHYQTPIEADDWCVPSK
EPKNLSRQSAAA
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atgcccccctgctgtcgtcatctctttgacagatttaaggggcgtgactactggggagag
ccaggaggcgtggctcaactctggccccgccccctcggggatataaataaaggctgcacg
tgccggggcaagtcagaaggaatcgagtcttcctcgagtgagattgtttggggaaggcaa
caaggcactccaggctcatcatccacaagcgtagccatgaaggctgctcggatcgcccta
cggaacgcgggccctttggccaccacgagccatggcctccctagcagcgggagggccacc
cgggaagtggagcattttgctcgttactcgccttcgcccctgtccatcaagcagttcctg
gatttcgggtcaactaatgcttgtgaaagaacctctttttcatttcttcggcatgaactt
cctgtgcggctagcaaatattctgaaagaaattgacctccttcctagtccattgttgagc
actccttcagtacagttagtaaaaagctggtatgtccaaagcctaatggaactggtggag
ttccatgataaaaaatctgatgaccacaaagttctatcagattttatagatgccattatt
aaagtcagaaaccgacatcatgatgtggtgcccacaatggcccagggagttctagaatac
agagattcatcaaagatggatccattcatcaatcaaaacattcagtacttcttggatcga
ttttacatgaaccggatatccattcgaatgctaataaaccaacacacacttatttttgac
aacaataatagtatcggtaatccaaggcacattggatgcattgacccatgctgtgatgtt
gttgacctggtgcatgatgctttccaaagtgcccagatgctttgtgaccagtattacttt
gcttctccagagttaaagctcactcaagtgaatggaaagacagctggacagcctattcac
atagtatatgtaccttctcatctctttcacatgctgtttgaactcttcaagaatgcaatg
agagcaacagttgaacatcaagaaagcaagccctcccttgatccagtagaagtgactgtt
gtacttggaaaggaagacctgtcaattaagatatctgatagaggaggtggtgtgccagtg
aggaaaattgaaagcctcttcagctacacatattctactgcaccaaagcctgtaatggat
aacaacaatacaactcctttggctggtttcggatatggattgccaatttctcgcctgtat
gctaaatactttcatggagacatcaatctttgttccatttctggctatgggacagatgct
ttgatttacttaaaggctctttccacagaatctatagaaaagcttcctgttttcaacaaa
tcagcctgcaagcattatcaaactcctatagaagcagatgactggtgtgttccaagtaaa
gaaccaaaaaatctgtcacgacagagtgcagctgcatga

DBGET integrated database retrieval system