KEGG   Anolis carolinensis (green anole): 100561020Help
Entry
100561020         CDS       T01608                                 

Gene name
xrcc4
Definition
(RefSeq) X-ray repair complementing defective repair in Chinese hamster cells 4
  KO
K10886  
DNA-repair protein XRCC4
Organism
acs  Anolis carolinensis (green anole)
Pathway
Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:acs00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    100561020 (xrcc4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
2
AA seq 331 aa AA seqDB search
MEKKVRRIYPLSEPGTTYFLQIVWEKDLGTGFDVILTDGQSAWSGRVPKEEISREAADME
MEQKKYVEELRKVFLTEGIPSNIYNFDISKEGTNGDCLHFSYEKKLRDLSFRLGSLKLQR
IPSPTEVISKLISCCLDFIVGLHAKNEHLQRENEILLNDLNEVQDQLQKCVEAKEELETE
LYKKFILVLNEKKAKIRNLQKCLKEAEETAVKATQARVVPESKAEEDYEGSTDEESENLV
EPSTSAPVKPKRDSLLSPDIIDIAPNRKRRQRVRNTASTEPKVALYEAQKISKEKVDSSK
PKSSDKQVSSKGMATEAGKNGGDPKDLFDDI
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atggagaagaaagtgagaagaatctatcctctttcagaaccaggcaccacctattttctg
caaatagtgtgggagaaagatctgggcaccggcttcgatgttatactcactgatggccaa
tcagcttggtctgggagagtgcctaaagaagagatttctagggaggctgctgacatggaa
atggagcaaaagaaatatgttgaagaacttagaaaagtgtttttaactgagggaatacct
tcaaatatctacaattttgatatttctaaagaggggacaaatggagactgccttcatttt
tcttatgaaaagaagttaagagatctatcttttagacttgggtcattgaagctacaaaga
atcccaagcccaactgaagtcatcagcaagctgattagttgttgcctagacttcattgta
ggactccatgccaaaaatgagcacctgcaaagagagaatgagatacttctaaatgatctg
aatgaagtgcaggaccagttacaaaaatgtgttgaagctaaagaagaactagagactgag
ttgtataaaaagtttatcctagtcctgaacgaaaagaaagcaaaaataaggaacttacag
aaatgtttaaaagaagctgaggaaacagcagtgaaagccacacaagcaagggttgtaccg
gaaagtaaagctgaagaagattatgaaggtagcactgatgaagaaagtgaaaatttggtg
gaaccttccacatcagcacctgtcaaacccaaaagagactcgttacttagtccagatatt
attgatattgctccaaatagaaagagaagacaacgtgtacgaaatactgcaagtacagaa
ccaaaggtggcattgtatgaggcccagaaaatatccaaggaaaaagttgattcttcgaag
ccaaaatcatcagacaagcaagtgtcttcaaaaggaatggctacagaggcaggaaaaaat
ggtggtgatcctaaagacctctttgatgatatctga

DBGET integrated database retrieval system