KEGG   Anolis carolinensis (green anole): 100561161Help
Entry
100561161         CDS       T01608                                 

Gene name
mrps18b
Definition
mitochondrial ribosomal protein S18B
Orthology
K16174  
small subunit ribosomal protein S18b, mitochondrial
Organism
acs  Anolis carolinensis (green anole)
Brite
Ribosome [BR:acs03011]
 Ribosomal Proteins
  Mitochondria
   Small subunit
    100561161 (mrps18b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
2
AA seq 249 aa AA seqDB search
MAASIGASLVCRAAGRVALRAALRKPFGVQKITCSCLLLPKQLAVHLYSTEVSQDESTEP
VGFDTESRFKDKPWEYLESEEYIERYGSNPVWFGYRRNHKGPIPPQKTRKTCIRGKHVCG
NPCPICRDQNLFLDYRNVKLLEQFVCPYTGIIYHPIHTGVCMKKYKQLTKAIEQSRENGL
LFFSIPFMDFQHEDFSNQHPAVTKTAPSPALQSKTAWYEWYDWQQPPEKELKRIRKIYKD
YLKEESGPP
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atggcggcctccataggcgcctcgcttgtgtgtcgggcggcaggccgtgtggcgctccgg
gcggctctccgaaagcctttcggagtccagaagataacttgctcttgtctcctgctaccc
aagcaattggctgttcacctttatagcacagaagtaagccaagatgaatccacagaacca
gttggttttgacacagaatcacgttttaaagacaagccttgggagtacttggagagtgaa
gaatacatagaacgatatggcagcaatcctgtctggtttggctacagacgtaatcacaag
ggcccaattcctccacagaagacacggaagacttgcattagagggaagcatgtgtgtggg
aacccctgtcccatctgcagagaccaaaacctttttctggattataggaatgtgaagctc
ctggaacagtttgtctgcccctacacaggtatcatctatcacccaatacacacaggtgtc
tgcatgaagaagtacaagcaattgaccaaagccattgagcagtctcgagaaaatggcctt
ctattcttctccatcccgttcatggactttcagcatgaagatttcagcaaccaacatcca
gctgtcactaagactgccccatctccagctcttcagagcaaaactgcctggtatgagtgg
tatgactggcagcagcctcctgaaaaggaactgaaacggatcaggaagatttacaaggac
tatctgaaggaagagagtggccctccttga

DBGET integrated database retrieval system