KEGG   Anolis carolinensis (green anole): 100561246Help
Entry
100561246         CDS       T01608                                 

Gene name
prkg2
Definition
protein kinase, cGMP-dependent, type II
Orthology
K07376  
protein kinase, cGMP-dependent [EC:2.7.11.12]
Organism
acs  Anolis carolinensis (green anole)
Pathway
Gap junction
Module
cGMP signaling
Brite
KEGG Orthology (KO) [BR:acs00001]
 Cellular Processes
  Cellular commiunity
   04540 Gap junction
    100561246 (prkg2)
Enzymes [BR:acs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.12  cGMP-dependent protein kinase
     100561246 (prkg2)
Protein kinases [BR:acs01001]
 Serine/threonine protein kinases: AGC group
  PKG family
   100561246 (prkg2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
5
AA seq 781 aa AA seqDB search
MGNGSVKHKYLKRQEGHAGNCPYGCPGGSSKFVKDQGVNISTITNAADILRSKVWELERE
LKRQEEELHERNYHILELQDQLAKQTRTIADLTEELKCKCIQLNKLQDVVDTQGTNPFLF
SPLKEVPKVSPVPCSNRRKGAKEGVSAEPTSRTYDLTEQPRFSFEKARVRKASSEKKLIT
EALSRNQFLKRLDPQQIRDMVECMYGRTYQQGSYIIKQGEPGNHIFVLAEGKVEVFQQNK
LLSSIPVWTAFGELAILYNCTRTASVKAVTIVKTWALDREVFQNIMRRTAQARHDQYRNF
LRSVSLLKNLPEDKLSKIVDCLEVEYYDKGDYIIREGEEGNTFFVIAKGKVKVTQTTDGQ
PQTQLIKTLQKGDYFGERALISDDVRSANIIADENDVECLVVDRETFNQTVGTFEELQAY
LAGYVATLARDDEKRNAQVSSLERLPSDVSLEMIQLKEKVAQFPSSCPFQNLEIVATLGV
GGFGRVELVKLKNESIAFAMKCIKKKHIVDTKQQEHIHSEKRILEEACSPFIVRLYRTFK
DNKYVYMLLEACLGGELWSILRDRGSFDETTTKFCVGCVTEAIEYLHCISVIYRDLKPEN
LILDAHGYIKLVDFGFAKKIAIGQKTWTFCGTPEYVAPEVILNKGHDFSVDFWSLGILVY
ELLTGNPPFSGADQMTTYNLILKGVERLDFPRIVSKRPEDLIRRLCRQNPTERLGNLKNG
IHDIKRHRWLNGFNWEGLKARKLSSPLKRELSGPMDYSYFDRYPPDQGIPPDELSGWDKD
F
NT seq 2346 nt NT seq  +upstreamnt  +downstreamnt
atgggaaatggttcagtgaaacacaagtacctcaagaggcaagaaggccatgcagggaac
tgcccgtacggctgcccaggtggcagcagcaagtttgtgaaagaccaaggtgtgaatatc
agcacaatcacaaatgctgcagatattctgagaagcaaggtttgggagctggagcgggag
ctgaagaggcaagaggaagagttgcacgagaggaactaccacatcctcgagctccaggat
cagctggcgaagcagaccaggaccattgcagacctcactgaagagctcaagtgtaaatgc
atccagctgaataagctgcaggatgtggtcgacacccagggaacaaaccccttcctgttt
tcccctcttaaagaagtacccaaggtcagcccagtgccatgcagcaacaggaggaaaggt
gccaaggaaggtgtgtcggcagagccaacaagccggacatacgacctgactgagcagcct
cggttttccttcgaaaaggcaagagtcagaaaggcctccagtgagaaaaagctcattacc
gaggctctgagcagaaaccaatttctgaagagactggatccacagcagatcagagatatg
gtagaatgtatgtatggaagaacataccagcaaggcagctatataatcaaacaaggggaa
cctggcaaccatatatttgtactagcagagggtaaagtggaagtctttcagcagaacaag
cttctctcatccattcctgtgtggacagcatttggggagttggctattttgtacaactgc
acaaggacagcctcagtgaaggctgtcactattgtgaaaacatgggcattagacagagag
gttttccaaaatataatgagaagaacagcacaagcaagacatgaccaatacagaaacttc
ctaagaagtgtgtctttgctgaagaatttacctgaagataagctgtcaaagatcgtggac
tgcttggaagtggaatactatgataagggtgattatattattcgtgaaggagaagaagga
aatacattctttgttatagccaaagggaaggttaaggtcacccagaccacggatggacag
ccacaaacccagttgattaaaacactacagaaaggagattactttggggaaagggccctc
atcagtgacgatgttcggtctgctaatataattgcggatgaaaatgatgtggagtgtctc
gttgtcgatagagaaaccttcaaccaaaccgttgggacttttgaagagctccaggcttac
cttgctggttacgtggctactctcgctcgtgatgatgaaaaaaggaatgcacaagtctct
tccttggagcgattacctagtgatgtctctttggagatgatacagctgaaagaaaaagtc
gcccagtttccttcctcttgcccatttcagaacctggaaattgttgctactctgggcgtt
ggtggatttggaagagttgagcttgtgaaacttaagaatgaaagcatagcatttgccatg
aaatgtattaagaaaaagcacatagtggataccaaacagcaggaacacattcattctgaa
aagagaattctagaagaggcttgctctccattcattgtgagattgtaccgaactttcaaa
gacaacaaatacgtttacatgcttttggaagcctgccttggaggtgaactatggagcatc
ctgagggacagaggtagctttgatgaaacaactacaaaattctgtgttggatgtgtgaca
gaagcaattgagtatttacattgcatcagtgtgatctacagggatctgaagccagaaaat
ttaattttggatgctcacggatatataaagctggttgactttggatttgctaagaagatt
gcaattggacaaaagacgtggaccttctgtgggactcccgaatatgttgcacctgaagtg
attctgaataaaggccatgatttcagtgtggacttctggtctcttggaatccttgtgtat
gaattgcttacagggaatcctccattttctggagccgatcaaatgacgacctacaatttg
attttaaaaggcgttgaaagattggattttccaagaatagtatcaaaacggccggaagat
ttgattcggaggctctgcagacaaaaccctactgagagattgggaaatctgaagaatggc
atccatgatattaagaggcacaggtggttgaatggatttaattgggaaggactcaaggca
aggaagttgtcctcacctttaaaaagagagctttcaggaccaatggattacagctacttc
gacagatacccacctgaccagggaatcccaccagatgaactttcaggctgggataaagat
ttctaa

DBGET integrated database retrieval system