KEGG   Anolis carolinensis (green anole): 100561246Help
Entry
100561246         CDS       T01608                                 

Gene name
prkg2
Definition
protein kinase, cGMP-dependent, type II
Orthology
K07376  
protein kinase, cGMP-dependent [EC:2.7.11.12]
Organism
acs  Anolis carolinensis (green anole)
Pathway
Gap junction
Class
Cellular Processes; Cell communication; Gap junction [PATH:acs04540]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
5
AA seq 757 aa AA seqDB search
MGNGSVKHKYLKRQEGHAGNCPYDILRSKVWELERELKRQEEELHERNYHILELQDQLAK
QTRTIADLTEELKCKCIQLNKLQDVVDTQGTNPFLFSPLKEVPKVSPVPCSNRRKGAKEG
VSAEPTSRTYDLTEQPRFSFEKARVRKASSEKKLITEALSRNQFLKRLDPQQIRDMVECM
YGRTYQQGSYIIKQGEPGNHIFVLAEGKVEVFQQNKLLSSIPVWTAFGELAILYNCTRTA
SVKAVTIVKTWALDREVFQNIMRRTAQARHDQYRNFLRSVSLLKNLPEDKLSKIVDCLEV
EYYDKGDYIIREGEEGNTFFVIAKGKVKVTQTTDGQPQTQLIKTLQKGDYFGERALISDD
VRSANIIADENDVECLVVDRETFNQTVGTFEELQAYLAGYVATLARDDEKRNAQVSSLER
LPSDVSLEMIQLKEKVAQFPSSCPFQNLEIVATLGVGGFGRVELVKLKNESIAFAMKCIK
KKHIVDTKQQEHIHSEKRILEEACSPFIVRLYRTFKDNKYVYMLLEACLGGELWSILRDR
GSFDETTTKFCVGCVTEAIEYLHCISVIYRDLKPENLILDAHGYIKLVDFGFAKKIAIGQ
KTWTFCGTPEYVAPEVILNKGHDFSVDFWSLGILVYELLTGNPPFSGADQMTTYNLILKG
VERLDFPRIVSKRPEDLIRRLCRQNPTERLGNLKNGIHDIKRHRWLNGFNWEGLKARKLS
SPLKRELSGPMDYSYFDRYPPDQGIPPDELSGWDKDF
NT seq 2274 nt NT seq  +upstreamnt  +downstreamnt
atgggaaatggttcagtgaaacacaagtacctcaagaggcaagaaggccatgcagggaac
tgcccgtacgatattctgagaagcaaggtttgggagctggagcgggagctgaagaggcaa
gaggaagagttgcacgagaggaactaccacatcctcgagctccaggatcagctggcgaag
cagaccaggaccattgcagacctcactgaagagctcaagtgtaaatgcatccagctgaat
aagctgcaggatgtggtcgacacccagggaacaaaccccttcctgttttcccctcttaaa
gaagtacccaaggtcagcccagtgccatgcagcaacaggaggaaaggtgccaaggaaggt
gtgtcggcagagccaacaagccggacatacgacctgactgagcagcctcggttttccttc
gaaaaggcaagagtcagaaaggcctccagtgagaaaaagctcattaccgaggctctgagc
agaaaccaatttctgaagagactggatccacagcagatcagagatatggtagaatgtatg
tatggaagaacataccagcaaggcagctatataatcaaacaaggggaacctggcaaccat
atatttgtactagcagagggtaaagtggaagtctttcagcagaacaagcttctctcatcc
attcctgtgtggacagcatttggggagttggctattttgtacaactgcacaaggacagcc
tcagtgaaggctgtcactattgtgaaaacatgggcattagacagagaggttttccaaaat
ataatgagaagaacagcacaagcaagacatgaccaatacagaaacttcctaagaagtgtg
tctttgctgaagaatttacctgaagataagctgtcaaagatcgtggactgcttggaagtg
gaatactatgataagggtgattatattattcgtgaaggagaagaaggaaatacattcttt
gttatagccaaagggaaggttaaggtcacccagaccacggatggacagccacaaacccag
ttgattaaaacactacagaaaggagattactttggggaaagggccctcatcagtgacgat
gttcggtctgctaatataattgcggatgaaaatgatgtggagtgtctcgttgtcgataga
gaaaccttcaaccaaaccgttgggacttttgaagagctccaggcttaccttgctggttac
gtggctactctcgctcgtgatgatgaaaaaaggaatgcacaagtctcttccttggagcga
ttacctagtgatgtctctttggagatgatacagctgaaagaaaaagtcgcccagtttcct
tcctcttgcccatttcagaacctggaaattgttgctactctgggcgttggtggatttgga
agagttgagcttgtgaaacttaagaatgaaagcatagcatttgccatgaaatgtattaag
aaaaagcacatagtggataccaaacagcaggaacacattcattctgaaaagagaattcta
gaagaggcttgctctccattcattgtgagattgtaccgaactttcaaagacaacaaatac
gtttacatgcttttggaagcctgccttggaggtgaactatggagcatcctgagggacaga
ggtagctttgatgaaacaactacaaaattctgtgttggatgtgtgacagaagcaattgag
tatttacattgcatcagtgtgatctacagggatctgaagccagaaaatttaattttggat
gctcacggatatataaagctggttgactttggatttgctaagaagattgcaattggacaa
aagacgtggaccttctgtgggactcccgaatatgttgcacctgaagtgattctgaataaa
ggccatgatttcagtgtggacttctggtctcttggaatccttgtgtatgaattgcttaca
gggaatcctccattttctggagccgatcaaatgacgacctacaatttgattttaaaaggc
gttgaaagattggattttccaagaatagtatcaaaacggccggaagatttgattcggagg
ctctgcagacaaaaccctactgagagattgggaaatctgaagaatggcatccatgatatt
aagaggcacaggtggttgaatggatttaattgggaaggactcaaggcaaggaagttgtcc
tcacctttaaaaagagagctttcaggaccaatggattacagctacttcgacagataccca
cctgaccagggaatcccaccagatgaactttcaggctgggataaagatttctaa

DBGET integrated database retrieval system