KEGG   Anolis carolinensis (green anole): 100561291Help
Entry
100561291         CDS       T01608                                 

Definition
cytochrome P450 1B1
Orthology
K07410  
cytochrome P450, family 1, subfamily B, polypeptide 1 [EC:1.14.14.1]
Organism
acs  Anolis carolinensis (green anole)
Pathway
Steroid hormone biosynthesis
Tryptophan metabolism
Metabolism of xenobiotics by cytochrome P450
Brite
KEGG Orthology (KO) [BR:acs00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    100561291
  Amino acid metabolism
   00380 Tryptophan metabolism
    100561291
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    100561291
Enzymes [BR:acs01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     100561291
Cytochrome P450 [BR:acs00199]
 Cytochrome P450, animal type
  CYP1 family
   100561291
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1
AA seq 619 aa AA seqDB search
MKALDSTESLMCSSSPPISGRAKPLLPAQKQRHVPRKASLQRRQIQARRARPSVPQASSR
GVGERAGRGSGDSGARKPLTLVCLFPCSARPRGLEEAPGSGEARLRGPLLLLLLLLLAAL
RRARRGGQGRRLPPGPFPWPLVGNAAQLGRAPHLALGRLAGVYGPVFRLRLGRWPVVVLS
GERAIRQALVRQGEAFAGRPPFPSFALVSGGHSLAFGASVAAWRAQRRVARAAVRAEAVR
AAAEAALVAEAAALVGLLARRGAGGAFLDPAPSLVLAVASLMSALCFGRRYGHDDEEFRR
LVGRNEQFGRAVGAGSLVDALPWLRRFPNPVRSAFRAFRALNRDFYGFVRGKFLRRRRIL
RLRPGDRARDLMDACIRLQQDRPGLPLEHVPATLTDIFGASQDTLSTALQWLLLCLVRYP
EVQTKLQEEIDKVVGRDRLPCAEDQPHLPYVMAFLYETMRFSSFVPVTIPHFTTMDTTLM
GYHIPKDTVIFVNQWSVNHDPVKWPSPEDFNPARFLYENGSLNKDLTSSVMIFSVGKRRC
IGEELSKAQLFLFIAILVHQCNFTANPKEDSKMDFTYGLTTKPKPFTLHVKLRDNLDLLG
KAVQRLQAEKDSENSLSDM
NT seq 1860 nt NT seq  +upstreamnt  +downstreamnt
atgaaagccttggacagcacggagtcattaatgtgcagctccagtccccctatttcgggg
cgggcgaagcctttacttccagcgcagaaacaaaggcacgtgcctaggaaggcctctctg
caaaggcgccaaattcaagcgcggagggcgcgcccaagtgtgcctcaggcctcctcacgc
ggcgtgggtgaacgagccggccggggctctggggattcgggggcccgaaagcccttaact
cttgtttgcctctttccctgcagcgcccgcccgcgtggcctggaggaagcgccggggagc
ggcgaggcccggctgcggggcccgctcctgctgctgctcttgctgctgctcgccgccctg
cgccgggcgcgccgcggaggacaaggccgccgcctcccgccgggcccgttcccgtggccg
ctggtgggcaacgcggctcagctgggccgcgcgccgcacttggcgctgggccgcctggcg
ggcgtgtacgggccggtgttccggctgcgcctgggccgctggcccgtggtggtgctgagc
ggggagcgcgccatccggcaggcgctggtgcggcagggggaggccttcgcgggccggccg
cccttcccgtccttcgcgctggtctccggcgggcacagcctggccttcggggcctcggtg
gcggcgtggcgcgcccagcggcgggtggcgcgggcggcggtgcgggcggaggcggtgcgg
gcggcggcggaggcggcgctggtggcggaggcggcggcgctggtgggcctgctggcgcgg
cgcggggcgggcggcgccttcctcgacccggcgcccagcctggtcctggccgtggccagc
ctcatgagcgcgctctgcttcgggcgccgctacgggcacgacgacgaggagttccgccgc
ctggtgggccgcaacgagcagttcgggcgcgccgtcggggccggcagcctggtggacgcc
ctgccctggctgcgccgcttccccaaccccgtccgctccgccttccgcgccttccgcgcc
ctcaaccgggacttctacggcttcgtgcggggaaagttcctccggcgccgccgcatcctc
cgcctccgccccggggaccgcgcccgcgaccttatggacgcctgcatccgcctccagcag
gaccggccggggctgccgctcgagcacgtgcccgccaccctcacggacatcttcggcgcc
agccaggacaccctctccaccgccctccagtggctcctcctctgcctcgtcaggtatcca
gaagtgcagactaaactgcaagaagaaatagataaagtagttggcagagaccgtttgcct
tgtgctgaggaccagccccacttgccttacgtaatggctttcctttatgaaaccatgcgt
ttcagcagctttgtgcctgttaccattcctcatttcactacaatggacactaccttgatg
ggttaccacattcctaaagacacagtgatcttcgtcaatcagtggtccgtaaatcacgat
ccagtcaaatggccatccccggaggatttcaacccagccagattcctgtatgagaatgga
tccctcaataaagacctcactagcagcgtcatgatcttttcagtgggcaagcgcagatgt
atcggggaagagttatccaaagcccagctctttctctttattgccatcctggtgcaccag
tgcaatttcactgccaatccaaaggaagattctaaaatggatttcacctatggcttgact
actaaaccaaagccatttacacttcacgtcaaattaagagataacttggatttgttaggt
aaagcagtccagagacttcaggcagaaaaagactctgagaattctttgtctgatatgtga

DBGET integrated database retrieval system