KEGG   Anolis carolinensis (green anole): 100561444Help
Entry
100561444         CDS       T01608                                 

Gene name
pik3cg
Definition
(RefSeq) phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit gamma
  KO
K21289  
phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit gamma [EC:2.7.1.153]
Organism
acs  Anolis carolinensis (green anole)
Pathway
Inositol phosphate metabolism
Adrenergic signaling in cardiomyocytes
Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:acs00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100561444 (pik3cg)
 Environmental Information Processing
  Signal transduction
   04371 Apelin signaling pathway
    100561444 (pik3cg)
 Organismal Systems
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100561444 (pik3cg)
Enzymes [BR:acs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     100561444 (pik3cg)
Membrane trafficking [BR:acs04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    100561444 (pik3cg)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
Position
5
AA seq 1098 aa AA seqDB search
MELEVNEQPVVMRDDNKRRRRRMKPYCTASSLSASELITIEFVLPTSNMLIDIASNCTVE
QMKAQIWMRAIERNQNSDYYHTFTPDQFVLQYQKKGQWYEIYDKHQIIQTLDCILYWKVL
QKKVGKIHVIQKQKPTKEVQEFQKQLNYLIGYDVTDISNVHDDELEFARRRLVTPRTIEV
SCRDPKLYSLHPWTTSKPLPDYMLSRIVNNSIFINIHRGTTSQKIKVAIDDTPDTILQSF
FTKMAKKKSLMNIPEDHNELDFVLRVSGRDEYIVGETPIRNFHWIRHCLKNGDEIHLVLD
DPPDPNQDEVQKEEWPLVDDCTGVSGYHEQLTIDGKDHERVFTISLWDCNRKFRVKIIGI
DIPVLPRNTDLTVFVEANIQHGQQLLSQKRTTAKPFTEEVLWNIWLEFDIKIKDLPKGAL
LTLQVYCGKAPASSTKANLQPHDSPSPDSKCKTQLLYYVNILLIDHRSLLRTGDYVLHMW
KISGKGEEQGSINADKLTSATNPDKENSMAISIVLDKYCHPVALPKHKIAADLQGDRARA
EMPNQLRKQLEEIIATDLLNPLTPEDKELLWHFRYESIKHPKAYPKLLSSVKWGQQEVVT
ETYQLLAKRDAWDLSTLDVGLPMQLLDCNFSDENVRAMAVQKLESLDDDDVLHYLLQLVQ
AVKFEPYHDSALARFLLKRGLRNKRIGHFLFWFLRSEIAQSMHYQQRFAVILEAHLRGCG
KAMLQDFLRQVQVIELLQKVTMEIKSLSAEKYDVTPQVITQLKQKLEKLQDCKFPECFRV
PYDPGLKAGALVIEKCKVMASKKKPLWLEFKCADPTSLSNETIGIIFKHGDDLRQDMLIL
QILRIMESIWEEESLDLCLLPYGCISTGNKIGMIEIVKDATTIAKIQQSTVGNTGAFKDE
ILNQWLKEKCVIEEKFQTAVERFVYSCAGYCVATFVLGIGDRHNDNIMITEAGNLFHIDF
GHILGNYKSFLGINKERVPFVLTPDFLFVMGTSGKKTSPRFQNFQDICVRAYLALRKHTN
LLIILFSMMLMTGMPQLTSKEDIEYIRDALTVGKNEEDAKKYFLDQIEVCRDKGWTVQFN
WFIHLVLGIKQGVEKHSA
NT seq 3297 nt NT seq  +upstreamnt  +downstreamnt
atggagctggaggtaaatgaacaacctgttgttatgagagacgacaacaaacggaggaga
aggaggatgaagccatactgtacagccagcagtttgtctgcatcagaactgataaccatt
gaatttgttctacccacaagcaacatgttaatagatatagccagcaactgtacagtagaa
cagatgaaagcacaaatttggatgcgggcaatagagcggaatcaaaactctgactactac
catacattcacacctgatcaatttgttcttcaataccaaaagaagggtcagtggtatgaa
atttatgacaaacatcagataatacagacactagactgcatattgtattggaaagtgttg
caaaagaaagttggcaaaattcacgtgattcaaaagcaaaagcccacaaaggaagttcag
gagtttcaaaagcaactcaattatttgattggctatgatgttactgatataagtaacgta
catgatgatgaactggaatttgctcgccgcagattagtcactccacggacaattgaagta
tcctgcagagatccaaaattatattcattgcacccttggactacatccaaaccacttcca
gattatatgcttagtaggattgtcaataatagcattttcataaacatccatagaggaaca
actagtcagaagattaaagtggccattgacgacactccagatacaatccttcagagcttt
ttcacaaaaatggcaaagaaaaaatctttaatgaatattcctgaagatcacaatgagctg
gactttgtccttagagtaagtggcagagatgaatatattgtaggtgagacaccaattaga
aatttccattggataagacattgtctgaaaaatggggacgaaattcaccttgtcctggat
gacccccctgacccaaaccaggatgaagtgcagaaagaggaatggcccttggtggatgac
tgcaccggagtctcaggatatcacgaacagttgacaatagatggcaaagatcatgagcgg
gtattcactatatcattgtgggactgcaataggaaattccgtgtcaagataattggcatt
gatatccctgtgctaccaagaaacacagaccttactgtatttgttgaagcgaatattcaa
catgggcagcagctgctttcacagaaaagaactactgctaagccatttactgaagaagtc
ctgtggaatatctggcttgagtttgatatcaagattaaagatttgcctaaaggtgcatta
ctaactctgcaggtatattgtggcaaagcaccagcatcatccactaaggctaatcttcag
ccacatgattctcccagtcctgattctaagtgtaaaacccagctactttattatgtcaat
attttactaatagaccaccgctcccttcttcggactggggattatgttctccatatgtgg
aaaatttcgggcaaaggggaagagcagggaagcataaatgctgataagcttacctcagcc
actaatccagataaagagaactcaatggctatctcaattgttctggacaagtattgccac
ccagttgctttgcccaaacacaaaatagcagctgatctgcaaggagaccgggccagagct
gaaatgcccaaccaactgcgcaaacagcttgaagagatcatagccacagacctgcttaat
ccacttacccctgaagacaaagaattactgtggcatttcagatatgaaagcataaagcat
ccaaaggcatatcctaagctgcttagctcagtgaaatggggacaacaagaagtagtaaca
gaaacatatcaattattagctaaaagagatgcgtgggacctcagcactttagatgttgga
ttaccaatgcaacttttagattgtaatttttctgatgaaaatgtgagagccatggcagtg
caaaaactagaaagtttagatgatgatgatgttcttcattatctcttgcaactagttcag
gctgtgaaatttgagccttatcatgacagtgcattggcccgattccttctaaaaagaggc
ttaagaaacaaaagaattggacactttttgttctggtttttaagaagtgagattgcacag
tccatgcactatcagcagagatttgctgtgatcctagaagctcatttgagaggttgtggg
aaagcgatgctgcaagacttcctgaggcaggttcaagtaattgaactgttgcaaaaagtg
acaatggagataaagtcactttctgctgaaaagtatgatgtcactcctcaagtaattaca
cagctcaaacaaaagcttgagaaactgcaggattgcaagtttcctgaatgcttcagagtc
ccatatgacccgggactgaaggcaggagcattggtgatagaaaaatgtaaagtaatggca
tccaagaaaaaacctctttggctagaattcaaatgtgcagatcctacatcactatccaat
gaaactattggcataatcttcaaacatggagatgatctgcggcaggacatgcttatttta
cagatacttcggataatggagtccatctgggaagaagaatccttagatttgtgtctgttg
ccatatggctgcatttctacagggaataaaataggaatgattgaaattgtaaaagatgct
acgacaattgccaaaatccagcaaagcacggttggaaacactggtgcatttaaggatgaa
atattaaaccagtggctcaaggagaaatgtgtaattgaagaaaagtttcagacagcagtg
gaaagatttgtgtactcttgtgctggttactgtgtggcaacctttgtacttggaatagga
gacagacataatgacaatattatgattacagaagcaggtaatctgtttcacattgacttt
ggccatattcttggaaattacaaaagcttccttggaatcaataaagaacgggttcctttt
gtgttgacgccagattttctttttgtgatgggaacctctgggaagaaaaccagtccacgc
tttcaaaattttcaggatatctgtgtgagggcttaccttgcacttcggaagcacacaaac
ctcctcatcatcctgttttctatgatgctaatgactggcatgcctcagctgactagcaag
gaagacattgaatatatccgtgatgctctaactgttggcaaaaatgaagaagatgctaaa
aagtatttcctagatcagattgaagtatgtagggataaaggctggacggtgcagttcaat
tggttcattcatcttgtgctgggaattaaacaaggagtagaaaaacactctgcctaa

DBGET integrated database retrieval system