KEGG   Anolis carolinensis (green anole): 100561503Help
Entry
100561503         CDS       T01608                                 

Definition
retinoic acid receptor RXR-alpha-like
Orthology
K08524  
retinoid X receptor alpha
Organism
acs  Anolis carolinensis (green anole)
Pathway
PPAR signaling pathway
Adipocytokine signaling pathway
Class
Organismal Systems; Endocrine system; Adipocytokine signaling pathway [PATH:acs04920]
Organismal Systems; Endocrine system; PPAR signaling pathway [PATH:acs03320]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
G
AA seq 451 aa AA seqDB search
FSTQVNSTSLSSPTSRGPMGAPSLHPPMGPLGSHAQLHSPISTLNSPINGMGPPFSVISS
AMGTHSISGPSPGLGFGTNSPQLNSPMNPVSSTEDIKPPLGINGVLKVPVHPSSAMASFT
KHICAICGDRSSGKHYGVYSCEGCKGFFKRTVRKDLTYTCRDNKDCLIDKRQRNRCQYCR
YQKCLAMGMKREAVQEERQRGKDRNENEVESTSNANEDMPVEKILEAELAVEPKTETYIE
ANMGLTPNSPNDPVTNICQAADKQLFTLVEWAKRIPHFSELPLDDQVILLRAGWNELLIA
SFSHRSIAVKDGILLATGLHVHRNSAHSAGVGAIFDRVLTELVSKMRDMQMDKTELGCLR
AIVLFNPDSKGLSNPAEVEALREKVYASLEAYCKHKYPDQPGRFAKLLLRLPALRSIGLK
CLEHLFFFKLIGDTPIDTFLMEMLEAPHQMT
NT seq 1358 nt NT seq  +upstreamnt  +downstreamnt
atttctccacccaggtcaattccacctccttgagttctccgacgagccggggtcctatgg
gcgccccttccctgcacccgccgatgggccccctggggtctcacgcccagctccactcgc
ccatcagcaccctgaattcgcccatcaacggcatggggcctccgttctccgtcatcagct
ctgccatggggacgcactcgatatccggaccgtcccctggccttgggttcggaacgaata
gcccgcagctcaactctcccatgaatccggtgagcagcacggaagacatcaagcctccct
tgggcatcaatggcgtccttaaagtgccagttcatccttcatcggccatggcctccttca
ccaagcacatatgtgccatctgtggcgaccgatcttcaggtaaacattacggcgtctaca
gctgtgagggctgcaagggcttcttcaagaggacggtgcggaaggacttgacctacacct
gccgcgacaataaggactgcttgattgacaagcgccagcggaaccgatgccaatattgcc
ggtaccagaagtgtcttgcgatgggcatgaaaagggaagctgtccaagaagagaggcagc
ggggcaaggaccgcaacgagaatgaggtcgagtcgacgagcaacgcaaacgaggacatgc
ccgtggagaagattctggaagcggagcttgctgtagagccaaagacggagacgtatattg
aagcaaacatgggcctgactccaaactcacccaatgatccggtcaccaacatctgccaag
cggcagacaagcagctcttcacgctggtggaatgggccaaaaggatcccccatttctccg
aactgcccctggatgaccaggtcatcttgctcagagccggttggaacgaattgctcattg
cgtccttctctcatcgatccatagccgtgaaagatgggatcttgctcgccacgggtctac
acgtccaccggaatagtgctcacagtgcgggggtcggcgctatctttgacagagtattga
cagagctggtgtcgaaaatgcgagacatgcagatggacaagacagagctgggctgcctcc
gagccattgtcctcttcaaccccgactccaagggtctatcgaatcccgccgaagttgagg
ctttgcgtgaaaaggtgtacgcgtcgctcgaagcttactgcaaacacaaataccccgacc
agcccggaaggttcgccaagctcttgcttcgcctccctgccctccggtccattggcctga
aatgcttggagcacctcttcttcttcaagctaataggggacacgccgatcgacacgttct
taatggagatgctggaagcgccgcatcaaatgacttaa

DBGET integrated database retrieval system