KEGG   Anolis carolinensis (green anole): 100561588Help
Entry
100561588         CDS       T01608                                 

Gene name
map2k3
Definition
(RefSeq) mitogen-activated protein kinase kinase 3
  KO
K04432  
mitogen-activated protein kinase kinase 3 [EC:2.7.12.2]
Organism
acs  Anolis carolinensis (green anole)
Pathway
MAPK signaling pathway
Toll-like receptor signaling pathway
GnRH signaling pathway
Module
MAPK (p38) signaling
Brite
KEGG Orthology (KO) [BR:acs00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100561588 (map2k3)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    100561588 (map2k3)
  Endocrine system
   04912 GnRH signaling pathway
    100561588 (map2k3)
Enzymes [BR:acs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     100561588 (map2k3)
Protein kinases [BR:acs01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   100561588 (map2k3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
Un
AA seq 351 aa AA seqDB search
MDGFECLEDSKGSLEKRKVGPKKKRPPILQMPPANKQSSVPPTPPRNLDSRTFITVGEKN
FEVEADDLVSIAELGRGAYGVVEKVHHAQSDTTMAVKRIRATVNTQEQKRLLMDLDISMR
TVDCFYTVTFYGALFREGDVWICMELMDTSLDKFYKRVLEKKKTIPEDILGKIAVSIVRA
LEHLHSKLSVIHRDVKPSNVLLNKQGHVKMCDFGISGYLVDSVAKTMDAGCKPYMAPERI
NPELNQRGYNVKSDVWSLGITLIEMAILHFPYESWGTPFQQLKQVVEEPSPQLPEDRFSK
DFVDFTAQCLRKNPAERMSYVELMAHPFFTLHDTKETDMVSFITEILADDS
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atggatggttttgaatgtttggaagattctaaaggatccttggaaaagcgcaaagtaggg
cccaagaagaaaaggccgcccattttgcaaatgccacccgccaataagcagtcgtctgtc
cctccgacgcctcccaggaacttggattcccggacttttattaccgttggtgagaaaaac
ttcgaagtggaggctgatgacttggtgagcattgccgagctaggaagaggggcctacggt
gtggtggagaaagtccatcacgcgcagagcgacaccaccatggctgtgaagaggatccgg
gcgaccgtgaacactcaggagcagaagcggctgctcatggacctggacatttccatgcgc
acggtggactgcttctataccgtcactttctacggagcccttttcagagagggcgacgtc
tggatctgcatggagctaatggacacgtccctggataagttttacaagagagtcttggaa
aagaagaaaaccatccctgaagacatcctggggaaaatagccgtgtctattgtgcgagca
cttgagcatttgcacagtaagctatctgtgattcacagagatgtcaagccctccaacgtc
ctgctcaataaacaagggcacgtcaaaatgtgtgattttgggatcagtggctacttggtg
gattcggtcgcaaagacgatggacgcaggctgcaaaccttacatggcccccgaaaggata
aaccccgaactgaaccaaaggggatataatgtgaaatcagatgtctggagccttggcatc
accttgatcgagatggccatcctccactttccctacgagtcttggggaacccctttccag
cagctaaagcaggtggtcgaagagccctctccgcagctccccgaagaccgcttctccaag
gactttgtggacttcacggcccagtgcttgaggaagaatcctgccgaacgaatgagctat
gtggaactcatggcgcacccgttcttcaccctgcacgacaccaaagagacggacatggtc
tccttcatcacagaaatcctcgcagacgattcttaa

DBGET integrated database retrieval system