KEGG   Anolis carolinensis (green anole): 100561588Help
Entry
100561588         CDS       T01608                                 

Definition
dual specificity mitogen-activated protein kinase kinase 3-like
Orthology
K04432  
mitogen-activated protein kinase kinase 3 [EC:2.7.12.2]
Organism
acs  Anolis carolinensis (green anole)
Pathway
MAPK signaling pathway
Toll-like receptor signaling pathway
GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:acs00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100561588
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    100561588
  Endocrine system
   04912 GnRH signaling pathway
    100561588
Enzymes [BR:acs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     100561588
Protein kinases [BR:acs01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   100561588
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 368 aa AA seqDB search
MGVGEAHLGKICVDLCCMDGFECLEDSKGSLEKRKVGPKKKRPPILQMPPANKQSSVPPT
PPRNLDSRTFITVGEKNFEVEADDLVSIAELGRGAYGVVEKVHHAQSDTTMAVKRIRATV
NTQEQKRLLMDLDISMRTVDCFYTVTFYGALFREGDVWICMELMDTSLDKFYKRVLEKKK
TIPEDILGKIAVSIVRALEHLHSKLSVIHRDVKPSNVLLNKQGHVKMCDFGISGYLVDSV
AKTMDAGCKPYMAPERINPELNQRGYNVKSDVWSLGITLIEMAILHFPYESWGTPFQQLK
QVVEEPSPQLPEDRFSKDFVDFTAQCLRKNPAERMSYVELMAHPFFTLHDTKETDMVSFI
TEILADDS
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgggagtgggagaagcccacttgggcaaaatctgtgttgatctttgctgcatggatggt
tttgaatgtttggaagattctaaaggatccttggaaaagcgcaaagtagggcccaagaag
aaaaggccgcccattttgcaaatgccacccgccaataagcagtcgtctgtccctccgacg
cctcccaggaacttggattcccggacttttattaccgttggtgagaaaaacttcgaagtg
gaggctgatgacttggtgagcattgccgagctaggaagaggggcctacggtgtggtggag
aaagtccatcacgcgcagagcgacaccaccatggctgtgaagaggatccgggcgaccgtg
aacactcaggagcagaagcggctgctcatggacctggacatttccatgcgcacggtggac
tgcttctataccgtcactttctacggagcccttttcagagagggcgacgtctggatctgc
atggagctaatggacacgtccctggataagttttacaagagagtcttggaaaagaagaaa
accatccctgaagacatcctggggaaaatagccgtgtctattgtgcgagcacttgagcat
ttgcacagtaagctatctgtgattcacagagatgtcaagccctccaacgtcctgctcaat
aaacaagggcacgtcaaaatgtgtgattttgggatcagtggctacttggtggattcggtc
gcaaagacgatggacgcaggctgcaaaccttacatggcccccgaaaggataaaccccgaa
ctgaaccaaaggggatataatgtgaaatcagatgtctggagccttggcatcaccttgatc
gagatggccatcctccactttccctacgagtcttggggaacccctttccagcagctaaag
caggtggtcgaagagccctctccgcagctccccgaagaccgcttctccaaggactttgtg
gacttcacggcccagtgcttgaggaagaatcctgccgaacgaatgagctatgtggaactc
atggcgcacccgttcttcaccctgcacgacaccaaagagacggacatggtctccttcatc
acagaaatcctcgcagacgattcttaa

DBGET integrated database retrieval system