KEGG   Anolis carolinensis (green anole): 100561589Help
Entry
100561589         CDS       T01608                                 

Definition
alpha-galactosidase A-like
Orthology
K01189  
alpha-galactosidase [EC:3.2.1.22]
Organism
acs  Anolis carolinensis (green anole)
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Glycosphingolipid biosynthesis - globo series
Lysosome
Brite
KEGG Orthology (KO) [BR:acs00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    100561589
  Lipid metabolism
   00561 Glycerolipid metabolism
    100561589
   00600 Sphingolipid metabolism
    100561589
  Glycan biosynthesis and metabolism
   00603 Glycosphingolipid biosynthesis - globo series
    100561589
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    100561589
Enzymes [BR:acs01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     100561589
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 393 aa AA seqDB search
MCRVATSSSRFFADFSFSLCSERLFMQMADLMVSDGWKDIGYEYLCIDDCWMAPTRDEQG
RLQPDPKRFPSGIGKLADYVHSKGLKLGIYADVGNKTCAGFPGSFGSYQLDAETFANWGV
DLLKFDGCSFGTLELLAEGYKTMSQALNKTGRSIVYSCEWPLYERPMQEPNYTEIKQYCN
YWRNYADIYDAWNSVKNVLDWTSYHQDSLVDIAGPGGWNDPDMLVIGDFGLSWDQQVTQM
ALWAIMAAPLLMSNDLRRINPQAKALLQNKDVIAINQDPLGKQGYRITKDNYFELWERPL
SGGAFAIAVVNRQEIGGPQAFAFSTAILGNGLACNPTCSIQQILPKSRDWGLHNWISFLK
VVVNPTGTVLLRTVVNKEALMFDQGTKRSQDIL
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgtgcagggttgccacctcctcttctcgtttttttgctgacttctccttttccctctgt
agcgagaggctgtttatgcagatggcggatctgatggtgtccgacgggtggaaagacata
ggctacgaatacctgtgtattgatgactgctggatggctcccacccgggatgagcagggc
aggctgcagcccgaccccaaacgctttcccagtgggatcggcaaactggccgactatgtc
cattccaaagggctgaagctgggcatctacgcagacgttgggaacaagacgtgtgctggt
ttccctggcagttttggctcctaccagctggacgcagagacctttgccaactggggagtg
gacttgctgaagttcgacggctgttcctttggcaccttggagctcctggcagaaggctat
aaaaccatgtctcaggctttgaataaaaccgggagaagcattgtctactcatgtgaatgg
ccgctctatgagagacccatgcaggagcccaactacacagagatcaaacagtactgcaat
tactggaggaattatgccgacatctacgatgcctggaacagcgtcaaaaatgtcttggat
tggacgtcttaccaccaggacagccttgtggacattgctggaccaggaggctggaatgac
ccagatatgctggtgattggggactttgggctgagctgggaccagcaagtgactcaaatg
gcactctgggccatcatggccgcccccctcctcatgtccaacgacttgcgccggataaat
ccccaggctaaggccctgctccagaacaaggatgtgatcgccatcaaccaggatccactg
ggcaagcaaggataccggattacaaaggataactactttgagctgtgggagcggcccctc
tccggaggcgcatttgccattgcggtggtgaaccggcaggagatcgggggcccacaggcc
tttgccttctccactgccatccttgggaacggcttggcttgcaaccccacttgctccatc
cagcagatcctccccaagagcagagactggggcctgcacaactggatctcattcctgaaa
gtagtggtgaacccgactggcaccgtgctgctgcggacggtggtgaataaggaggcactt
atgtttgaccaaggaaccaagcgctcccaggacatcttataa

DBGET integrated database retrieval system