KEGG   Anolis carolinensis (green anole): 100561589Help
Entry
100561589         CDS       T01608                                 

Gene name
gla
Definition
(RefSeq) galactosidase alpha
  KO
K01189  alpha-galactosidase [EC:3.2.1.22]
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs00052  Galactose metabolism
acs00561  Glycerolipid metabolism
acs00600  Sphingolipid metabolism
acs00603  Glycosphingolipid biosynthesis - globo and isoglobo series
acs04142  Lysosome
Brite
KEGG Orthology (KO) [BR:acs00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    100561589 (gla)
  Lipid metabolism
   00561 Glycerolipid metabolism
    100561589 (gla)
   00600 Sphingolipid metabolism
    100561589 (gla)
  Glycan biosynthesis and metabolism
   00603 Glycosphingolipid biosynthesis - globo and isoglobo series
    100561589 (gla)
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    100561589 (gla)
Enzymes [BR:acs01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     100561589 (gla)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Melibiase_2 Melibiase_2_C Melibiase
Motif
Other DBs
NCBI-GeneID: 100561589
NCBI-ProteinID: XP_003227134
Ensembl: ENSACAG00000008537
Position
Un
AA seq 427 aa AA seqDB search
MAAMAGLLPLVLLGMARWSGALENGLARTPPMGWLHWERFLCQTDCGQEPLQCVSERLFM
QMADLMVSDGWKDIGYEYLCIDDCWMAPTRDEQGRLQPDPKRFPSGIGKLADYVHSKGLK
LGIYADVGNKTCAGFPGSFGSYQLDAETFANWGVDLLKFDGCSFGTLELLAEGYKTMSQA
LNKTGRSIVYSCEWPLYERPMQEPNYTEIKQYCNYWRNYADIYDAWNSVKNVLDWTSYHQ
DSLVDIAGPGGWNDPDMLVIGDFGLSWDQQVTQMALWAIMAAPLLMSNDLRRINPQAKAL
LQNKDVIAINQDPLGKQGYRITKDNYFELWERPLSGGAFAIAVVNRQEIGGPQAFAFSTA
ILGNGLACNPTCSIQQILPKSRDWGLHNWISFLKVVVNPTGTVLLRTVVNKEALMFDQGT
KRSQDIL
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atggcggccatggccgggctgctcccgcttgtgctgctggggatggcgcggtggagcgga
gccctggagaacggcctggcccgcacgccgcccatgggctggctccactgggagcgcttc
ctctgccagaccgactgcgggcaggagccactccagtgcgtcagcgagaggctgtttatg
cagatggcggatctgatggtgtccgacgggtggaaagacataggctacgaatacctgtgt
attgatgactgctggatggctcccacccgggatgagcagggcaggctgcagcccgacccc
aaacgctttcccagtgggatcggcaaactggccgactatgtccattccaaagggctgaag
ctgggcatctacgcagacgttgggaacaagacgtgtgctggtttccctggcagttttggc
tcctaccagctggacgcagagacctttgccaactggggagtggacttgctgaagttcgac
ggctgttcctttggcaccttggagctcctggcagaaggctataaaaccatgtctcaggct
ttgaataaaaccgggagaagcattgtctactcatgtgaatggccgctctatgagagaccc
atgcaggagcccaactacacagagatcaaacagtactgcaattactggaggaattatgcc
gacatctacgatgcctggaacagcgtcaaaaatgtcttggattggacgtcttaccaccag
gacagccttgtggacattgctggaccaggaggctggaatgacccagatatgctggtgatt
ggggactttgggctgagctgggaccagcaagtgactcaaatggcactctgggccatcatg
gccgcccccctcctcatgtccaacgacttgcgccggataaatccccaggctaaggccctg
ctccagaacaaggatgtgatcgccatcaaccaggatccactgggcaagcaaggataccgg
attacaaaggataactactttgagctgtgggagcggcccctctccggaggcgcatttgcc
attgcggtggtgaaccggcaggagatcgggggcccacaggcctttgccttctccactgcc
atccttgggaacggcttggcttgcaaccccacttgctccatccagcagatcctccccaag
agcagagactggggcctgcacaactggatctcattcctgaaagtagtggtgaacccgact
ggcaccgtgctgctgcggacggtggtgaataaggaggcacttatgtttgaccaaggaacc
aagcgctcccaggacatcttataa

DBGET integrated database retrieval system