KEGG   Anolis carolinensis (green anole): 100561616Help
Entry
100561616         CDS       T01608                                 

Definition
cyclin-H-like
Orthology
K06634  
cyclin H
Organism
acs  Anolis carolinensis (green anole)
Pathway
Basal transcription factors
Nucleotide excision repair
Cell cycle
Class
Genetic Information Processing; Transcription; Basal transcription factors [PATH:acs03022]
Genetic Information Processing; Replication and repair; Nucleotide excision repair [PATH:acs03420]
Cellular Processes; Cell growth and death; Cell cycle [PATH:acs04110]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
2
AA seq 323 aa AA seqDB search
MYQSSTQRRHWTFRSEEELTRRRADANRKFRCKAVSNGKVREENGDSFLLEPHEELAICK
YYEKRLLDFCSVFKPIMPKSVVGSACMYFKRFYLNNSVMEYHPRIIMLTCAFLACKVDEF
NVSSAQFVSNLRESPVGQEKALEQILEYELLLIQELNFHLIVHNPYRPFEGFLIDLKTRY
SLLENPETLRKAADDFLNRAALTDACLLYTPSQIALTAILSSASRAGINMESYLSESLML
KENKASFTQLLDGMKCMKHLVKKYELPHPEKIPALKQKLEKCHSPELALNTNTKKRKGYE
DDEYVAKKSKMEEDEWTDDDLID
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgtatcagagcagcacgcagaggcggcactggaccttccgctccgaggaggagctcact
cgacgccgggccgatgccaaccgcaagttccgctgcaaagcggtgtccaatgggaaggtg
agggaggagaacggggactcatttcttcttgagcctcatgaggagttggcaatttgcaaa
tattatgaaaaaagattattggatttttgctccgtattcaaaccaataatgccaaaatct
gtggtgggatcagcctgcatgtacttcaaacgtttttacctcaataactctgtgatggag
tatcacccgcgtataataatgttgacgtgtgcattcttggcatgtaaagtagatgaattc
aatgtgtctagtgcacagtttgttagtaaccttcgtgaaagcccagtgggacaggaaaag
gctcttgaacagatcttagaatatgaattgctacttattcaggaactcaacttccatctc
atagtacacaacccatatagaccatttgaaggcttcttgattgatctgaagacacgttat
tcattgcttgagaatcctgagacattgaggaaggcggcagatgactttcttaatcgagca
gctttgacagatgcttgcctcctatatacaccttctcagatagctcttactgccatcttg
tcaagtgcttctagggcaggaattaatatggaaagttacttgtcagaaagcctaatgctg
aaagagaacaaagcttccttcacccaattgctggatggaatgaaatgcatgaaacatctg
gtaaaaaaatatgagctaccacatccagaaaaaattcctgctctaaaacagaagctagag
aaatgtcatagtccagaacttgcccttaatacaaatacaaagaagaggaaaggctatgaa
gacgatgaatacgttgcaaagaaatctaaaatggaggaggatgaatggacagatgatgac
ttgattgactga

DBGET integrated database retrieval system