KEGG   Anolis carolinensis (green anole): 100561616Help
Entry
100561616         CDS       T01608                                 

Gene name
ccnh
Definition
(RefSeq) cyclin H
  KO
K06634  
cyclin H
Organism
acs  Anolis carolinensis (green anole)
Pathway
Basal transcription factors
Nucleotide excision repair
Cell cycle
Module
Holo-TFIIH complex
Brite
KEGG Orthology (KO) [BR:acs00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    100561616 (ccnh)
  Replication and repair
   03420 Nucleotide excision repair
    100561616 (ccnh)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    100561616 (ccnh)
Transcription machinery [BR:acs03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     100561616 (ccnh)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
2
AA seq 323 aa AA seqDB search
MYQSSTQRRHWTFRSEEELTRRRADANRKFRCKAVSNGKVREENGDSFLLEPHEELAICK
YYEKRLLDFCSVFKPIMPKSVVGSACMYFKRFYLNNSVMEYHPRIIMLTCAFLACKVDEF
NVSSAQFVSNLRESPVGQEKALEQILEYELLLIQELNFHLIVHNPYRPFEGFLIDLKTRY
SLLENPETLRKAADDFLNRAALTDACLLYTPSQIALTAILSSASRAGINMESYLSESLML
KENKASFTQLLDGMKCMKHLVKKYELPHPEKIPALKQKLEKCHSPELALNTNTKKRKGYE
DDEYVAKKSKMEEDEWTDDDLID
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgtatcagagcagcacgcagaggcggcactggaccttccgctccgaggaggagctcact
cgacgccgggccgatgccaaccgcaagttccgctgcaaagcggtgtccaatgggaaggtg
agggaggagaacggggactcatttcttcttgagcctcatgaggagttggcaatttgcaaa
tattatgaaaaaagattattggatttttgctccgtattcaaaccaataatgccaaaatct
gtggtgggatcagcctgcatgtacttcaaacgtttttacctcaataactctgtgatggag
tatcacccgcgtataataatgttgacgtgtgcattcttggcatgtaaagtagatgaattc
aatgtgtctagtgcacagtttgttagtaaccttcgtgaaagcccagtgggacaggaaaag
gctcttgaacagatcttagaatatgaattgctacttattcaggaactcaacttccatctc
atagtacacaacccatatagaccatttgaaggcttcttgattgatctgaagacacgttat
tcattgcttgagaatcctgagacattgaggaaggcggcagatgactttcttaatcgagca
gctttgacagatgcttgcctcctatatacaccttctcagatagctcttactgccatcttg
tcaagtgcttctagggcaggaattaatatggaaagttacttgtcagaaagcctaatgctg
aaagagaacaaagcttccttcacccaattgctggatggaatgaaatgcatgaaacatctg
gtaaaaaaatatgagctaccacatccagaaaaaattcctgctctaaaacagaagctagag
aaatgtcatagtccagaacttgcccttaatacaaatacaaagaagaggaaaggctatgaa
gacgatgaatacgttgcaaagaaatctaaaatggaggaggatgaatggacagatgatgac
ttgattgactga

DBGET integrated database retrieval system