KEGG   Anolis carolinensis (green anole): 100561616Help
Entry
100561616         CDS       T01608                                 

Definition
cyclin-H-like
Orthology
K06634  
cyclin H
Organism
acs  Anolis carolinensis (green anole)
Pathway
Basal transcription factors
Nucleotide excision repair
Cell cycle
Module
Holo-TFIIH complex
Brite
KEGG Orthology (KO) [BR:acs00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    100561616
  Replication and repair
   03420 Nucleotide excision repair
    100561616
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    100561616
Transcription machinery [BR:acs03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     100561616
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
2
AA seq 323 aa AA seqDB search
MYQSSTQRRHWTFRSEEELTRRRADANRKFRCKAVSNGKVREENGDSFLLEPHEELAICK
YYEKRLLDFCSVFKPIMPKSVVGSACMYFKRFYLNNSVMEYHPRIIMLTCAFLACKVDEF
NVSSAQFVSNLRESPVGQEKALEQILEYELLLIQELNFHLIVHNPYRPFEGFLIDLKTRY
SLLENPETLRKAADDFLNRAALTDACLLYTPSQIALTAILSSASRAGINMESYLSESLML
KENKASFTQLLDGMKCMKHLVKKYELPHPEKIPALKQKLEKCHSPELALNTNTKKRKGYE
DDEYVAKKSKMEEDEWTDDDLID
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgtatcagagcagcacgcagaggcggcactggaccttccgctccgaggaggagctcact
cgacgccgggccgatgccaaccgcaagttccgctgcaaagcggtgtccaatgggaaggtg
agggaggagaacggggactcatttcttcttgagcctcatgaggagttggcaatttgcaaa
tattatgaaaaaagattattggatttttgctccgtattcaaaccaataatgccaaaatct
gtggtgggatcagcctgcatgtacttcaaacgtttttacctcaataactctgtgatggag
tatcacccgcgtataataatgttgacgtgtgcattcttggcatgtaaagtagatgaattc
aatgtgtctagtgcacagtttgttagtaaccttcgtgaaagcccagtgggacaggaaaag
gctcttgaacagatcttagaatatgaattgctacttattcaggaactcaacttccatctc
atagtacacaacccatatagaccatttgaaggcttcttgattgatctgaagacacgttat
tcattgcttgagaatcctgagacattgaggaaggcggcagatgactttcttaatcgagca
gctttgacagatgcttgcctcctatatacaccttctcagatagctcttactgccatcttg
tcaagtgcttctagggcaggaattaatatggaaagttacttgtcagaaagcctaatgctg
aaagagaacaaagcttccttcacccaattgctggatggaatgaaatgcatgaaacatctg
gtaaaaaaatatgagctaccacatccagaaaaaattcctgctctaaaacagaagctagag
aaatgtcatagtccagaacttgcccttaatacaaatacaaagaagaggaaaggctatgaa
gacgatgaatacgttgcaaagaaatctaaaatggaggaggatgaatggacagatgatgac
ttgattgactga

DBGET integrated database retrieval system