KEGG   Anolis carolinensis (green anole): 100561625Help
Entry
100561625         CDS       T01608                                 

Definition
serine/threonine-protein kinase PAK 2-like
Orthology
K04410  
p21-activated kinase 2 [EC:2.7.11.1]
Organism
acs  Anolis carolinensis (green anole)
Pathway
MAPK signaling pathway
ErbB signaling pathway
Focal adhesion
Regulation of actin cytoskeleton
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:acs04010]
Environmental Information Processing; Signal transduction; ErbB signaling pathway [PATH:acs04012]
Cellular Processes; Cell motility; Regulation of actin cytoskeleton [PATH:acs04810]
Cellular Processes; Cell communication; Focal adhesion [PATH:acs04510]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
3
AA seq 479 aa AA seqDB search
MSDNGELEDKPPAPPVRMSSTIFSPASKDPLSANHSLKPLPSVPEEKKPRNKIISIFSGT
EKGSRKKEKERPEISPPSDFEHTIHVGFDAVTGEFTYLSFSATEKDGFPSGAPAPNAKVS
EPSAAAEEEDDDEVAPPIIAPRPDHTKSIYTRSVIDPLPAPSGDSSDSAAKSADRQKKKT
KMSDEEIMERLRTIVSIGDPKKKYTRYEKIGQGASGTVFIAIDVATGQEVAIKQINLQKQ
PKKELIINEILVMKELKNPNIVNFLDSYLVGDELFVVMEYLAGGSLTDVVTETCMDEAQI
AAVCRECLQALEFLHANQVIHRDIKSDNVLLGMDGSVKLTDFGFCAQITPEQSKRSTMVG
TPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMVEGEPPYLNENPLRALYLIATNGTPELQN
PEKLSPIFRDFLNSCLEMDVEKRGSGKDLLQHPFLKLAKPLSSLTPLILAAKEAMKSNR
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgtctgataatggggaactcgaagacaagccaccagctccacctgttcggatgagcagc
actatcttcagtccagccagcaaagatccattatcagctaatcacagcttgaaacctctg
ccatctgtgccagaggagaagaagcctaggaataaaatcatctctattttttctggcact
gaaaaaggaagtaggaaaaaggaaaaagaaaggcctgaaatttctcctccatcagacttt
gaacataccattcatgttggctttgatgctgttactggggaattcacttatctgagcttc
tctgctacagaaaaggatggattcccttcaggagcaccagcacccaatgcaaaagtctca
gagccttctgcagcagctgaagaagaggatgatgatgaagtggctcctccaattattgcc
ccccgaccagatcatacaaaatctatttacacacggtcagtaatagatccccttccagca
ccatccggtgactcaagtgacagtgctgctaaatcagctgataggcagaaaaagaaaact
aaaatgtcagatgaagagatcatggaaaggctacgaacaattgtgagcataggcgatcct
aagaaaaaatataccagatatgaaaaaattgggcaaggggcttcaggtacagttttcatt
gctatagatgtggcaacaggacaggaggttgccattaaacagataaatcttcagaaacag
cccaagaaagagttaattatcaatgaaattttagtaatgaaagaactgaagaacccaaat
atagtcaactttctagacagttacctagtaggggatgaactctttgtcgtaatggaatat
ctggctggtggatctctcacagatgtagttacagagacttgtatggatgaagcacagatt
gctgctgtctgcagagagtgtcttcaggcactggaattcctccatgcaaatcaggtgatt
cacagagatatcaaaagtgacaatgtgctcttgggaatggatggatccgttaagctgact
gactttggtttctgcgctcagattactccagagcagagcaaacgtagcactatggttggg
acaccttactggatggctcctgaagtggtcacacggaaggcatatggccctaaagtggat
atctggtctctgggcatcatggctattgaaatggttgaaggcgagcccccatatctcaat
gaaaaccccttgagggcactgtatttgatagcaactaatggcaccccagaactacaaaat
cctgaaaaactctccccaatattccgtgactttctaaatagctgtttggaaatggatgtt
gagaaaagagggtcaggcaaagacctgttacagcatcctttcctgaaactggccaaacct
ttgtcaagcttgacgccgttgatcctagcagccaaagaagcaatgaagagtaaccgttag

DBGET integrated database retrieval system