KEGG   Anolis carolinensis (green anole): 100561625Help
Entry
100561625         CDS       T01608                                 

Gene name
pak2
Definition
(RefSeq) p21 (RAC1) activated kinase 2
  KO
K04410  
p21-activated kinase 2 [EC:2.7.11.1]
Organism
acs  Anolis carolinensis (green anole)
Pathway
MAPK signaling pathway
ErbB signaling pathway
Focal adhesion
Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:acs00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100561625 (pak2)
   04012 ErbB signaling pathway
    100561625 (pak2)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    100561625 (pak2)
  Cellular community - eukaryotes
   04510 Focal adhesion
    100561625 (pak2)
Enzymes [BR:acs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100561625 (pak2)
Protein kinases [BR:acs01001]
 Serine/threonine protein kinases: STE group
  STE20 family
   100561625 (pak2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
3
AA seq 524 aa AA seqDB search
MASQQGVSTPSQLVSPGHLASPVPNPPPSGVLSNSLSIMSDNGELEDKPPAPPVRMSSTI
FSPASKDPLSANHSLKPLPSVPEEKKPRNKIISIFSGTEKGSRKKEKERPEISPPSDFEH
TIHVGFDAVTGEFTVSISSLAFLSFSATEKDGFPSGAPAPNAKVSEPSAAAEEEDDDEVA
PPIIAPRPDHTKSIYTRSVIDPLPAPSGDSSDSAAKSADRQKKKTKMSDEEIMERLRTIV
SIGDPKKKYTRYEKIGQGASGTVFIAIDVATGQEVAIKQINLQKQPKKELIINEILVMKE
LKNPNIVNFLDSYLVGDELFVVMEYLAGGSLTDVVTETCMDEAQIAAVCRECLQALEFLH
ANQVIHRDIKSDNVLLGMDGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAY
GPKVDIWSLGIMAIEMVEGEPPYLNENPLRALYLIATNGTPELQNPEKLSPIFRDFLNSC
LEMDVEKRGSGKDLLQHPFLKLAKPLSSLTPLILAAKEAMKSNR
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atggcctcccagcagggcgtgagcactccatcccagctggtttcaccagggcatttggcc
tcacctgtgcccaatccacctcccagtggtgtattgtctaattcattaagtatcatgtct
gataatggggaactcgaagacaagccaccagctccacctgttcggatgagcagcactatc
ttcagtccagccagcaaagatccattatcagctaatcacagcttgaaacctctgccatct
gtgccagaggagaagaagcctaggaataaaatcatctctattttttctggcactgaaaaa
ggaagtaggaaaaaggaaaaagaaaggcctgaaatttctcctccatcagactttgaacat
accattcatgttggctttgatgctgttactggggaattcactgtaagtatatcaagctta
gcttttctgagcttctctgctacagaaaaggatggattcccttcaggagcaccagcaccc
aatgcaaaagtctcagagccttctgcagcagctgaagaagaggatgatgatgaagtggct
cctccaattattgccccccgaccagatcatacaaaatctatttacacacggtcagtaata
gatccccttccagcaccatccggtgactcaagtgacagtgctgctaaatcagctgatagg
cagaaaaagaaaactaaaatgtcagatgaagagatcatggaaaggctacgaacaattgtg
agcataggcgatcctaagaaaaaatataccagatatgaaaaaattgggcaaggggcttca
ggtacagttttcattgctatagatgtggcaacaggacaggaggttgccattaaacagata
aatcttcagaaacagcccaagaaagagttaattatcaatgaaattttagtaatgaaagaa
ctgaagaacccaaatatagtcaactttctagacagttacctagtaggggatgaactcttt
gtcgtaatggaatatctggctggtggatctctcacagatgtagttacagagacttgtatg
gatgaagcacagattgctgctgtctgcagagagtgtcttcaggcactggaattcctccat
gcaaatcaggtgattcacagagatatcaaaagtgacaatgtgctcttgggaatggatgga
tccgttaagctgactgactttggtttctgcgctcagattactccagagcagagcaaacgt
agcactatggttgggacaccttactggatggctcctgaagtggtcacacggaaggcatat
ggccctaaagtggatatctggtctctgggcatcatggctattgaaatggttgaaggcgag
cccccatatctcaatgaaaaccccttgagggcactgtatttgatagcaactaatggcacc
ccagaactacaaaatcctgaaaaactctccccaatattccgtgactttctaaatagctgt
ttggaaatggatgttgagaaaagagggtcaggcaaagacctgttacagcatcctttcctg
aaactggccaaacctttgtcaagcttgacgccgttgatcctagcagccaaagaagcaatg
aagagtaaccgttag

DBGET integrated database retrieval system