KEGG   Anolis carolinensis (green anole): 100561674Help
Entry
100561674         CDS       T01608                                 

Gene name
unc13c
Definition
(RefSeq) protein unc-13 homolog C
  KO
K15293  
protein unc-13 A/B/C
Organism
acs  Anolis carolinensis (green anole)
Brite
Membrane trafficking [BR:acs04131]
 SNARE
  SNARE associated proteins
   Syntaxin-binding proteins
    100561674 (unc13c)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
Un
AA seq 2236 aa AA seqDB search
MVSALFQSLLSSYLYKIYKGMFTKKLGNSTKRKESCQSKKEPLEVPQPGPTKSPTFSKTL
KSTVRKIAKCSSARNLSTEEEAGSQEFSLSPTFSYRVAIANGLQRSLFTAHKHEDLPPDP
SSNESSFSDSLSEARSAGREPLSHTMPVRRNRKSLSSLAPSDGSSDGERTLHSLKLGALR
KLRKWKKSQECVSSDSELSAWKKAWGLRSKSLDRTARPPKASPTEPSFSSTGCISQTHDV
MEMIFKELQGISQIETELSELRGHVNALKQSIDEISSSVEVVQSEIEQLRTGFVQSRRET
RDIHDYIKQIGQVGGKASLRFLNVPEEKCENVERVVHRILAEKMGFSETQNTVKVEFAHR
VGPQRDCPNAKPRPILAYFETPQQRDLVLKKSYKLKGTGISVSTDLLSSHEVREKKERSL
PSSQTYESMDMKPPAAEGRAKKHAWESPDSSSDRELEPDINRNSYAKISKSAPQMKRSPT
KVREASLNAGALQGVADVSKFPTHIVHNEASPATEDLPKEQLGTSYATMTPLWQSQSDFC
TLKLSRSESDFSKLCQSYSEDFSENPYFSRTNGSSLLSSSDRELWQRTHDDSSAWHRSSQ
EQAFGQEEPFYRAEDEADNAEAMDSGVSNGLLCASGDRSHYSNSQVSLEEGDLSPWTEWN
QLEQDTDLGLDSSTQDAFTYDLSSSSDQQLDYGQISEAQYDDAEGNDFALDGHSPSGQDL
SGEAQDPWPLQYSDYPESNANTLYQNQNRPPIMYRSQSELPSDNTSLEEVPPKSWHSRLS
IDLSDKTFSFPKFGNTLQRARSALEVVWNKSTQSLSGGEENSSSFMGRFRTLSQSTANES
STTLDSDVYTEPYYYKAEEEEEAAYSEPVAENETDYVEVMEQVLAKLENRTGAQEAEGEP
APEQTPEETPEETPYESPHDSLPSATPEGPFPIEEEELEEEVLEYVVHSPLEEEVEEVHE
DENRNLPEVPIPAPVKKKVRPSFKEAALRAYKKQMSELEEKILAGDSSSVDEKARIVSGG
PLQASKLAIQAFAGPNSALYGIDSMPDLRRKKSFPIVRDVALKTLAARKSGISLAMLIRT
SVNNEEMKMHVFKKTLQALIYPMSSTTPHYFEVWTATAPTYCYECEGLLWGIARQGMRCT
ECGVKCHEKCQDLLNADCLQRAAEKSSKHGAEDKTQNIIAAMKDQMKVREKNHPEVFELI
WETFQIPKEDISQHLKAAKQSVLEGTSKWSAKITITVVCAQGLQAKDKTGSSDPYVTVQV
GKTKRRTKTIFGNLNPTWEEKFFFECHNSTDRIKVRVWDEDDDIKSRVKQHFKRESDDFL
GQTIIEVRTLSGEMDVWYNLDKRTDKSAVSGAIRLKLNVEIKGEEKVSPYHIQYTCLHES
LFHHLTEVKSGGAVQIPSVKGDDAWKVYFEDTAQEIVDEFAMRYGIEYIYQAMTHFSCLS
SKYMCPGVPAVTSTLLANINAFYAHTTATTNVSASDRFAATNFGREKFVKLLDQLHNSLR
IDLSKYRENFPASSPERLQDLKSTVDLLTSITFFRLKVLELQSPPRASAVVKDCVRACLD
STYRYIFDNCYELYAQLMDQGKKPEVSREEQGPTIQNLDFWTQLITLMVTIIDEDRTAYT
PVLNQFPQELNMGRVSAEIMWGLFAQDMKYALEEHEKQRVCKSIDYMNLHFKVKWFYNEY
VREIPSFRDSVPEYSLQRHAAGLSKLGACRERPDMSGADFYLPASTRRVGLSPSLPMRDR
DNVNLIGSSQILPSFFPWPQFQQTSDHALFSCSVVDVFTQLNQSFEIIRKLECPNPEALS
HLMRRFAKTIHKVLTQYAVIVTNDFSSYCDRENLPCILMNNIQQLRVQLEKMFEAMGGKE
LDPEASSALKDLQAKLSGVLDDLSVIYGDSFQPVVGECVRQMAAELNQLKAENNKGNCVV
EAEIVLRPLMDFLDKTLSASAKICEKTVLKRVLKELWKLVLNTIEKQIVLPPLTDQTGPP
MLLSAAKDFGQLSKLKDHVIREDTKSLSLRQCAVMDVVLATIKQYFHAGGSGLKKTFLEK
SPDMQSLKYALNLYTQTTDVLITKFIDTQATQNQGTEKPVGEINVQLEVVPQPGTGEHKV
TIKVIAINKLQWQTSNMFRPFVEVFLLGPSLSDKRRRHGTKTKSNTWSPKYNETFQFVVG
KEGGSSEFRRPRESKRDQNTAKAIRAACLDPDHESPTEAVRGQTPWIPEGGVAIQTGLSS
GGEPWPKNRRRAGGGC
NT seq 6711 nt NT seq  +upstreamnt  +downstreamnt
atggtttctgcgctcttccagagtctgctctcttcctacctatataagatttacaaagga
atgtttacaaagaaattggggaacagtacaaagaggaaagagagctgccagagcaaaaag
gagccgctagaggtccctcagccgggcccgaccaagagccccacgttctccaaaacccta
aagagcaccgtccggaagatcgccaagtgctcctccgcccgcaacctctccactgaagag
gaggctggcagccaggagttctccctctcgcccaccttcagctaccgggtggccatcgcc
aacggcctgcagaggagcctcttcaccgcccacaagcatgaggacctccccccggacccc
tcctccaacgagagctccttctccgactcgctgagtgaagccaggagtgctggccgggag
cctttgtcgcacacgatgcctgtgcggcgcaaccggaagagcctgagcagcctggccccc
tcggacggcagctccgatggggagcgcaccctgcacagcctgaagctgggcgcgctgagg
aagctgcggaaatggaagaagagccaggagtgcgtctcctccgactcggaactcagcgcc
tggaagaaggcctggggcctgcggagcaagtccctcgaccggactgcccgcccacccaag
gccagccccaccgagcccagcttcagctccacagggtgcatcagccagacccacgatgtg
atggagatgatcttcaaggagctccagggcatcagccagatcgagacggagctctcggag
ctgcggggccacgtcaatgccctcaagcagtccattgacgagatctccagcagcgtggag
gtggtccaaagtgagatcgagcagctgcggaccgggttcgtgcagtcgcggcgggagaca
cgggacatccacgactacatcaagcagattgggcaggtgggtggcaaggccagcctgcgc
ttcctgaatgtccctgaggagaagtgcgagaacgtggagcgcgtggtgcaccggattttg
gcagagaagatgggcttctcagagacgcagaacacagtgaaggtcgagttcgcccaccgg
gtgggaccgcagagggactgccccaacgccaagccccggcccatcctggcctactttgag
accccgcagcagagggacctggtcctgaagaagtcctacaagctcaaagggactggcatc
agcgtctcgacggacctgctgtcttctcatgaggtgagagagaagaaggagaggagcctg
ccttcctcgcagacgtacgagagcatggatatgaagccgccggctgcggaggggagagcc
aagaagcatgcctgggagtcccccgacagcagcagcgacagagaactggagcccgatatc
aaccggaacagttacgcaaagatctccaagtcggccccgcagatgaagaggagccccacc
aaggtgagagaggcgtcgctaaacgccggagccctccagggagtcgcagacgtcagcaag
tttccgactcacattgtccacaatgaagcatcgcccgcaacggaggacttgcccaaggag
caactgggcaccagctacgccaccatgacccccctctggcagtcccagagcgacttctgc
accctcaagctcagtcgctctgagtcggacttctccaaactctgccagtcctactcggaa
gacttttcggagaacccgtacttcagccggaccaacggcagctcgctcttgtcttcctcc
gaccgggagctctggcagaggacgcacgacgacagctccgcctggcaccgcagttcgcag
gagcaggcttttggccaagaagagcccttctaccgagctgaggacgaagcagacaatgcc
gaagccatggatagtggcgtcagcaacggcctgctgtgcgcctctggggaccggagccat
tacagcaactcccaagtctccttggaggagggggacctttcgccctggacggagtggaac
cagctggaacaagacacagacctgggcttggactcctccactcaagatgccttcacctac
gacctgagcagctcttccgaccaacagctagactatggccagatctctgaggctcagtac
gacgatgcggaaggcaacgactttgccctggacggtcactctccttccggacaggatctc
agcggcgaggcgcaggacccgtggcccctccagtacagcgactatccggagagcaacgcc
aacactctgtaccagaaccagaaccgcccacccatcatgtaccgcagccaaagtgaactg
ccgagcgacaacacctcccttgaggaggtgccccctaaatcctggcacagccggctgagc
atcgacctgtccgacaagacgttcagcttccctaaattcgggaacaccttgcagcgggca
cggtctgcgttggaggtggtctggaacaagagcacgcagagcctcagcggcggagaggag
aacagctcctcgttcatggggcgcttccggactttgtcccagtcgacggccaacgagtcg
agcaccaccttggattcggatgtttacaccgagccctactactacaaggccgaggaggag
gaggaagcagcatacagcgagcctgttgctgagaacgagacggactacgtggaggtcatg
gagcaagttctggccaagttggagaaccggacgggggcccaggaggcggaaggagagccg
gcgccggaacagacgccagaggagacaccagaggagacgccctacgagagcccacacgac
agcctccccagtgccacccccgaagggcctttccccattgaggaggaggagttggaggaa
gaagtcttggagtatgtggtccattcccccctcgaggaggaagtggaagaagtgcacgag
gatgagaaccggaatctccccgaagtccctattccggcaccagtgaagaagaaagtgcgc
ccgtctttcaaagaggctgcactgagggcctacaagaaacagatgagtgagctggaggag
aagatcctggctggagacagcagttctgtggatgaaaaggcccgcattgtctctggcgga
cccctccaggcctccaagctcgccatccaggcttttgctggcccaaacagcgctctgtac
gggatcgacagcatgccggacctgcggcgcaagaagtccttccccatcgtccgggacgtg
gccttgaagacgctggctgcccggaagtccggcatctcgctggccatgctcatccggacc
tccgtcaacaatgaggagatgaaaatgcacgtgttcaagaagacgctgcaggcgctgatc
tacccgatgtcctccaccaccccgcactacttcgaggtctggacggccacggcccccacc
tactgctacgagtgcgaggggctgctctggggcattgcccggcaaggcatgcgctgcacc
gagtgcggggtcaagtgccacgagaagtgccaggacctgctcaacgcagactgcttgcag
agggctgccgagaagagctccaagcacggggcagaggacaagacccagaacatcattgcg
gccatgaaggaccagatgaaggtccgggagaagaaccacccggaggtctttgagctgatc
tgggagaccttccagatccccaaggaggacatctcccagcacctgaaggcagccaagcag
agcgtcctggaggggacctccaagtggtcggccaagatcaccatcacggtggtgtgtgcc
cagggcctgcaggccaaggacaagacgggctccagcgacccctacgtcacggtgcaggtg
ggcaagaccaagcgcaggaccaagaccatcttcgggaacctgaaccccacctgggaggag
aagttcttcttcgagtgccacaactccaccgaccgcatcaaggtccgggtctgggacgag
gacgacgacatcaagtcccgggtgaagcagcacttcaagcgggaatcggacgacttcctg
gggcagaccatcatcgaagtgcggacgctgagcggagagatggacgtctggtacaacctc
gacaagcgcacggacaagtctgccgtgtcgggggccatccgactgaagctcaacgtggag
atcaaaggggaggagaaggtctcgccgtatcatatccagtacacctgcctccacgagagc
ctcttccaccacctgacggaggtgaagtctggcggggcagtgcagatcccgtccgtcaaa
ggggacgacgcctggaaggtctactttgaggacactgctcaggagatcgtggacgagttt
gccatgcgctacgggatcgagtacatctaccaggccatgacgcacttctcctgcctctcc
tccaagtacatgtgtccgggggtcccagccgtcacgagcaccttgctggccaacatcaac
gccttctacgcccacaccacggccaccactaacgtctccgcctccgaccgctttgcggcc
accaacttcgggagggaaaagtttgtcaaactgctggaccagctgcacaattccttgagg
attgacctctccaagtacagggaaaacttccccgccagcagccctgagcggctccaggac
ctgaagtccaccgtggatctgctgacgagcatcacgttcttccgcctgaaggtgctggag
ctgcagagcccccccagggccagcgccgtggtcaaggactgcgtccgcgcctgcctggac
tccacctacaggtacatcttcgacaactgctacgaactctacgctcagctcatggaccag
ggcaagaagccagaggtgtcgcgggaggaacagggccccaccatccagaacctggacttc
tggacgcagctcatcaccctcatggtcaccatcatcgacgaggaccggacagcctacaca
cccgtcttgaaccagttcccccaggagctgaacatgggcagggtcagcgcggagatcatg
tggggcctctttgcccaggacatgaagtacgcgctggaagagcatgaaaagcagcgggta
tgcaagagcatcgattatatgaatttgcacttcaaagtgaagtggttttataatgaatac
gtgagagagatcccctccttccgggactcggtgcccgaatactccctgcagcgacatgca
gcaggtctctccaagctgggtgcttgccgggagagaccagacatgtccggtgcagacttt
tatctcccggcaagcacccggcgcgtgggcttgagcccaagtttgcccatgcgtgataga
gacaatgtaaatctaattgggagttcacaaatccttccttccttcttcccttggcctcag
ttccagcagacctctgaccacgcgctcttctcctgctccgtggtggacgtcttcacgcag
ctcaaccagagcttcgagatcatccggaagctggagtgccccaacccggaggccctctcc
cacctcatgaggaggtttgccaagaccatccacaaagtgctcactcaatacgccgtcatc
gtcacgaacgacttcagctcttactgtgacagagaaaacctgccctgcatcctgatgaac
aacatccagcaactgcgggtccagctggagaagatgtttgaagccatggggggcaaggag
ctggaccccgaggccagctccgccctcaaggacctgcaggccaagctcagcggcgtcctg
gacgacctcagcgtcatctacggagacagtttccagccggtggtcggggagtgcgtgagg
cagatggcggccgagctgaaccagctgaaggcggagaacaacaagggcaactgcgtggtg
gaagccgagatcgtcctgcgaccgctgatggacttccttgacaaaacgttaagcgcctcg
gccaaaatctgcgagaagacggtgctcaagcgggtcttgaaggagctctggaagctggtg
ctgaacaccatcgagaagcagatcgtcctcccgcccttgaccgaccaaaccgggcctccc
atgcttctcagcgcagccaaagacttcggccagctctccaagctgaaggaccacgtcatc
cgggaagacaccaagagcctgtcgctgaggcagtgtgccgtcatggacgtggtcctggcc
accattaagcaatacttccatgccggagggagcggcctgaagaagaccttcctggagaag
agccccgacatgcagtcgctcaagtacgccctcaacctctacacgcagaccaccgacgtc
ctgatcaccaagttcatcgacacccaggcaacgcaaaatcaagggacagagaagccggtg
ggggagatcaacgtccagctggaggtcgttccgcagcccgggaccggagagcacaaagtg
accatcaaagtgatcgccatcaacaagctgcagtggcagacgagcaacatgttccgcccc
ttcgtggaggtcttcctcctgggccccagcctgagcgacaagcgccggaggcacggcacc
aagaccaagagcaacacctggtcgcccaagtacaacgagaccttccagttcgtggtgggc
aaggagggaggttcttcagagttcagaagaccaagagaaagcaagcgggatcaaaataca
gcaaaggctattcgagccgcctgcttggaccctgatcatgaaagccccacagaagcggtg
cggggacaaactccctggatcccggaggggggtgttgcaatccaaacggggctcagctct
gggggagagccttggcccaagaaccggagaagagctggtggtggctgctga

DBGET integrated database retrieval system