KEGG   Anolis carolinensis (green anole): 100561674Help
Entry
100561674         CDS       T01608                                 

Definition
protein unc-13 homolog C-like
Orthology
K15293  
protein unc-13
Organism
acs  Anolis carolinensis (green anole)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 2225 aa AA seqDB search
MVSALFQSLLSSYLYKIYKGMFTKKLGNSTKRKESCQSKKEPLEVPQPGPTKSPTFSKTL
KSTVRKIAKCSSARNLSTEEEAGSQEFSLSPTFSYRVAIANGLQRSLFTAHKHEDLPPDP
SSNESSFSDSLSEARSAGREPLSHTMPVRRNRKSLSSLAPSDGSSDGERTLHSLKLGALR
KLRKWKKSQECVSSDSELSAWKKAWGLRSKSLDRTARPPKASPTEPSFSSTGCISQTHDV
MEMIFKELQGISQIETELSELRGHVNALKQSIDEISSSVEVVQSEIEQLRTGFVQSRRET
RDIHDYIKQIGQVGGKASLRFLNVPEEKCENVERVVHRILAEKMGFSETQNTVKVEFAHR
VGPQRDCPNAKPRPILAYFETPQQRDLVLKKSYKLKGTGISVSTDLLSSHEVREKKERSL
PSSQTYESMDMKPPAAEGRAKKHAWESPDSSSDRELEPDINRNSYAKISKSAPQMKRSPT
KVREASLNAGALQGVADVSKFPTHIVHNEASPATEDLPKEQLGTSYATMTPLWQSQSDFC
TLKLSRSESDFSKLCQSYSEDFSENPYFSRTNGSSLLSSSDRELWQRTHDDSSAWHRSSQ
EQAFGQEEPFYRAEDEADNAEAMDSGVSNGLLCASGDRSHYSNSQVSLEEGDLSPWTEWN
QLEQDTDLGLDSSTQDAFTYDLSSSSDQQLDYGQISEAQYDDAEGNDFALDGHSPSGQDL
SGEAQDPWPLQYSDYPESNANTLYQNQNRPPIMYRSQSELPSDNTSLEEVPPKSWHSRLS
IDLSDKTFSFPKFGNTLQRARSALEVVWNKSTQSLSGGEENSSSFMGRFRTLSQSTANES
STTLDSDVYTEPYYYKAEEEEEAAYSEPVAENETDYVEVMEQVLAKLENRTGAQEAEGEP
APEQTPEETPEETPYESPHDSLPSATPEGPFPIEEEELEEEVLEYVVHSPLEEEVEEVHE
DENRNLPEVPIPAPVKKKVRPSFKEAALRAYKKQMSELEEKILAGDSSSVDEKARIVSGG
PLQASKLAIQAFAGPNSALYGIDSMPDLRRKKSFPIVRDVVSTLAARKSGISLAMLIRTS
VNNEEMKMHVFKKTLQALIYPMSSTTPHYFEVWTATAPTYCYECEGLLWGIARQGMRCTE
CGVKCHEKCQDLLNADCLQRAAEKSSKHGAEDKTQNIIAAMKDQMKVREKNHPEVFELIW
ETFQIPKEDISQHLKAAKQSVLEGTSKWSAKITITVVCAQGLQAKDKTGSSDPYVTVQVG
KTKRRTKTIFGNLNPTWEEKFFFECHNSTDRIKVRVWDEDDDIKSRVKQHFKRESDDFLG
QTIIEVRTLSGEMDVWYNLDKRTDKSAVSGAIRLKLNVEIKGEEKVSPYHIQYTCLHESL
FHHLTEVKSGGAVQIPSVKGDDAWKVYFEDTAQEIVDEFAMRYGIEYIYQAMTHFSCLSS
KYMCPGVPAVTSTLLANINAFYAHTTATTNVSASDRFAATNFGREKFVKLLDQLHNSLRI
DLSKYRENFPASSPERLQDLKSTVDLLTSITFFRLKVLELQSPPRASAVVKDCVRACLDS
TYRYIFDNCYELYAQLMDQGKKPEVSREEQGPTIQNLDFWTQLITLMVTIIDEDRTAYTP
VLNQFPQELNMGRVSAEIMWGLFAQDMKYALEEHEKQRVCKSIDYMNLHFKVKWFYNEYV
REIPSFRDSVPEYSLQRHAAGLSKLGACRERPDMSGADFYLPASTRRVGLSPSLPMRDRD
NFQQTSDHALFSCSVVDVFTQLNQSFEIIRKLECPNPEALSHLMRRFAKTIHKVLTQYAV
IVTNDFSSYCDRENLPCILMNNIQQLRVQLEKMFEAMGGKELDPEASSALKDLQAKLSGV
LDDLSVIYGDSFQPVVGECVRQMAAELNQLKAENNKGNCVVEAEIVLRPLMDFLDKTLSA
SAKICEKTVLKRVLKELWKLVLNTIEKQIVLPPLTDQTGPPMLLSAAKDFGQLSKLKDHV
IREDTKSLSLRQCAVMDVVLATIKQYFHAGGSGLKKTFLEKSPDMQSLKYALNLYTQTTD
VLITKFIDTQATQNQGTEKPVGEINVQLEVVPQPGTGEHKVTIKVIAINKLQWQTSNMFR
PFVEVFLLGPSLSDKRRRHGTKTKSNTWSPKYNETFQFVVGKEGXXXXXXXXGSSEFRRP
RESKRDQNTAKAIRAACLDPDHESPTEAVRGQTPWIPEGGVAIQTGLSSGGEPWPKNRRR
AGGGC
NT seq 6678 nt NT seq  +upstreamnt  +downstreamnt
atggtttctgcgctcttccagagtctgctctcttcctacctatataagatttacaaagga
atgtttacaaagaaattggggaacagtacaaagaggaaagagagctgccagagcaaaaag
gagccgctagaggtccctcagccgggcccgaccaagagccccacgttctccaaaacccta
aagagcaccgtccggaagatcgccaagtgctcctccgcccgcaacctctccactgaagag
gaggctggcagccaggagttctccctctcgcccaccttcagctaccgggtggccatcgcc
aacggcctgcagaggagcctcttcaccgcccacaagcatgaggacctccccccggacccc
tcctccaacgagagctccttctccgactcgctgagtgaagccaggagtgctggccgggag
cctttgtcgcacacgatgcctgtgcggcgcaaccggaagagcctgagcagcctggccccc
tcggacggcagctccgatggggagcgcaccctgcacagcctgaagctgggcgcgctgagg
aagctgcggaaatggaagaagagccaggagtgcgtctcctccgactcggaactcagcgcc
tggaagaaggcctggggcctgcggagcaagtccctcgaccggactgcccgcccacccaag
gccagccccaccgagcccagcttcagctccacagggtgcatcagccagacccacgatgtg
atggagatgatcttcaaggagctccagggcatcagccagatcgagacggagctctcggag
ctgcggggccacgtcaatgccctcaagcagtccattgacgagatctccagcagcgtggag
gtggtccaaagtgagatcgagcagctgcggaccgggttcgtgcagtcgcggcgggagaca
cgggacatccacgactacatcaagcagattgggcaggtgggtggcaaggccagcctgcgc
ttcctgaatgtccctgaggagaagtgcgagaacgtggagcgcgtggtgcaccggattttg
gcagagaagatgggcttctcagagacgcagaacacagtgaaggtcgagttcgcccaccgg
gtgggaccgcagagggactgccccaacgccaagccccggcccatcctggcctactttgag
accccgcagcagagggacctggtcctgaagaagtcctacaagctcaaagggactggcatc
agcgtctcgacggacctgctgtcttctcatgaggtgagagagaagaaggagaggagcctg
ccttcctcgcagacgtacgagagcatggatatgaagccgccggctgcggaggggagagcc
aagaagcatgcctgggagtcccccgacagcagcagcgacagagaactggagcccgatatc
aaccggaacagttacgcaaagatctccaagtcggccccgcagatgaagaggagccccacc
aaggtgagagaggcgtcgctaaacgccggagccctccagggagtcgcagacgtcagcaag
tttccgactcacattgtccacaatgaagcatcgcccgcaacggaggacttgcccaaggag
caactgggcaccagctacgccaccatgacccccctctggcagtcccagagcgacttctgc
accctcaagctcagtcgctctgagtcggacttctccaaactctgccagtcctactcggaa
gacttttcggagaacccgtacttcagccggaccaacggcagctcgctcttgtcttcctcc
gaccgggagctctggcagaggacgcacgacgacagctccgcctggcaccgcagttcgcag
gagcaggcttttggccaagaagagcccttctaccgagctgaggacgaagcagacaatgcc
gaagccatggatagtggcgtcagcaacggcctgctgtgcgcctctggggaccggagccat
tacagcaactcccaagtctccttggaggagggggacctttcgccctggacggagtggaac
cagctggaacaagacacagacctgggcttggactcctccactcaagatgccttcacctac
gacctgagcagctcttccgaccaacagctagactatggccagatctctgaggctcagtac
gacgatgcggaaggcaacgactttgccctggacggtcactctccttccggacaggatctc
agcggcgaggcgcaggacccgtggcccctccagtacagcgactatccggagagcaacgcc
aacactctgtaccagaaccagaaccgcccacccatcatgtaccgcagccaaagtgaactg
ccgagcgacaacacctcccttgaggaggtgccccctaaatcctggcacagccggctgagc
atcgacctgtccgacaagacgttcagcttccctaaattcgggaacaccttgcagcgggca
cggtctgcgttggaggtggtctggaacaagagcacgcagagcctcagcggcggagaggag
aacagctcctcgttcatggggcgcttccggactttgtcccagtcgacggccaacgagtcg
agcaccaccttggattcggatgtttacaccgagccctactactacaaggccgaggaggag
gaggaagcagcatacagcgagcctgttgctgagaacgagacggactacgtggaggtcatg
gagcaagttctggccaagttggagaaccggacgggggcccaggaggcggaaggagagccg
gcgccggaacagacgccagaggagacaccagaggagacgccctacgagagcccacacgac
agcctccccagtgccacccccgaagggcctttccccattgaggaggaggagttggaggaa
gaagtcttggagtatgtggtccattcccccctcgaggaggaagtggaagaagtgcacgag
gatgagaaccggaatctccccgaagtccctattccggcaccagtgaagaagaaagtgcgc
ccgtctttcaaagaggctgcactgagggcctacaagaaacagatgagtgagctggaggag
aagatcctggctggagacagcagttctgtggatgaaaaggcccgcattgtctctggcgga
cccctccaggcctccaagctcgccatccaggcttttgctggcccaaacagcgctctgtac
gggatcgacagcatgccggacctgcggcgcaagaagtccttccccatcgtccgggacgtg
gtgagtacgctggctgcccggaagtccggcatctcgctggccatgctcatccggacctcc
gtcaacaatgaggagatgaaaatgcacgtgttcaagaagacgctgcaggcgctgatctac
ccgatgtcctccaccaccccgcactacttcgaggtctggacggccacggcccccacctac
tgctacgagtgcgaggggctgctctggggcattgcccggcaaggcatgcgctgcaccgag
tgcggggtcaagtgccacgagaagtgccaggacctgctcaacgcagactgcttgcagagg
gctgccgagaagagctccaagcacggggcagaggacaagacccagaacatcattgcggcc
atgaaggaccagatgaaggtccgggagaagaaccacccggaggtctttgagctgatctgg
gagaccttccagatccccaaggaggacatctcccagcacctgaaggcagccaagcagagc
gtcctggaggggacctccaagtggtcggccaagatcaccatcacggtggtgtgtgcccag
ggcctgcaggccaaggacaagacgggctccagcgacccctacgtcacggtgcaggtgggc
aagaccaagcgcaggaccaagaccatcttcgggaacctgaaccccacctgggaggagaag
ttcttcttcgagtgccacaactccaccgaccgcatcaaggtccgggtctgggacgaggac
gacgacatcaagtcccgggtgaagcagcacttcaagcgggaatcggacgacttcctgggg
cagaccatcatcgaagtgcggacgctgagcggagagatggacgtctggtacaacctcgac
aagcgcacggacaagtctgccgtgtcgggggccatccgactgaagctcaacgtggagatc
aaaggggaggagaaggtctcgccgtatcatatccagtacacctgcctccacgagagcctc
ttccaccacctgacggaggtgaagtctggcggggcagtgcagatcccgtccgtcaaaggg
gacgacgcctggaaggtctactttgaggacactgctcaggagatcgtggacgagtttgcc
atgcgctacgggatcgagtacatctaccaggccatgacgcacttctcctgcctctcctcc
aagtacatgtgtccgggggtcccagccgtcacgagcaccttgctggccaacatcaacgcc
ttctacgcccacaccacggccaccactaacgtctccgcctccgaccgctttgcggccacc
aacttcgggagggaaaagtttgtcaaactgctggaccagctgcacaattccttgaggatt
gacctctccaagtacagggaaaacttccccgccagcagccctgagcggctccaggacctg
aagtccaccgtggatctgctgacgagcatcacgttcttccgcctgaaggtgctggagctg
cagagcccccccagggccagcgccgtggtcaaggactgcgtccgcgcctgcctggactcc
acctacaggtacatcttcgacaactgctacgaactctacgctcagctcatggaccagggc
aagaagccagaggtgtcgcgggaggaacagggccccaccatccagaacctggacttctgg
acgcagctcatcaccctcatggtcaccatcatcgacgaggaccggacagcctacacaccc
gtcttgaaccagttcccccaggagctgaacatgggcagggtcagcgcggagatcatgtgg
ggcctctttgcccaggacatgaagtacgcgctggaagagcatgaaaagcagcgggtatgc
aagagcatcgattatatgaatttgcacttcaaagtgaagtggttttataatgaatacgtg
agagagatcccctccttccgggactcggtgcccgaatactccctgcagcgacatgcagca
ggtctctccaagctgggtgcttgccgggagagaccagacatgtccggtgcagacttttat
ctcccggcaagcacccggcgcgtgggcttgagcccaagtttgcccatgcgtgatagagac
aatttccagcagacctctgaccacgcgctcttctcctgctccgtggtggacgtcttcacg
cagctcaaccagagcttcgagatcatccggaagctggagtgccccaacccggaggccctc
tcccacctcatgaggaggtttgccaagaccatccacaaagtgctcactcaatacgccgtc
atcgtcacgaacgacttcagctcttactgtgacagagaaaacctgccctgcatcctgatg
aacaacatccagcaactgcgggtccagctggagaagatgtttgaagccatggggggcaag
gagctggaccccgaggccagctccgccctcaaggacctgcaggccaagctcagcggcgtc
ctggacgacctcagcgtcatctacggagacagtttccagccggtggtcggggagtgcgtg
aggcagatggcggccgagctgaaccagctgaaggcggagaacaacaagggcaactgcgtg
gtggaagccgagatcgtcctgcgaccgctgatggacttccttgacaaaacgttaagcgcc
tcggccaaaatctgcgagaagacggtgctcaagcgggtcttgaaggagctctggaagctg
gtgctgaacaccatcgagaagcagatcgtcctcccgcccttgaccgaccaaaccgggcct
cccatgcttctcagcgcagccaaagacttcggccagctctccaagctgaaggaccacgtc
atccgggaagacaccaagagcctgtcgctgaggcagtgtgccgtcatggacgtggtcctg
gccaccattaagcaatacttccatgccggagggagcggcctgaagaagaccttcctggag
aagagccccgacatgcagtcgctcaagtacgccctcaacctctacacgcagaccaccgac
gtcctgatcaccaagttcatcgacacccaggcaacgcaaaatcaagggacagagaagccg
gtgggggagatcaacgtccagctggaggtcgttccgcagcccgggaccggagagcacaaa
gtgaccatcaaagtgatcgccatcaacaagctgcagtggcagacgagcaacatgttccgc
cccttcgtggaggtcttcctcctgggccccagcctgagcgacaagcgccggaggcacggc
accaagaccaagagcaacacctggtcgcccaagtacaacgagaccttccagttcgtggtg
ggcaaggagggannnnnnnnnnnnnnnnnnnnnnnnggttcttcagagttcagaagacca
agagaaagcaagcgggatcaaaatacagcaaaggctattcgagccgcctgcttggaccct
gatcatgaaagccccacagaagcggtgcggggacaaactccctggatcccggaggggggt
gttgcaatccaaacggggctcagctctgggggagagccttggcccaagaaccggagaaga
gctggtggtggctgctga

DBGET integrated database retrieval system