KEGG   Anolis carolinensis (green anole): 100561693Help
Entry
100561693         CDS       T01608                                 

Definition
(RefSeq) cytochrome P450 2J2-like
  KO
K07418  
cytochrome P450, family 2, subfamily J [EC:1.14.14.1]
Organism
acs  Anolis carolinensis (green anole)
Pathway
Arachidonic acid metabolism
Linoleic acid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:acs00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    100561693
   00591 Linoleic acid metabolism
    100561693
Enzymes [BR:acs01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     100561693
Cytochrome P450 [BR:acs00199]
 Cytochrome P450, animal type
  CYP2 family
   100561693
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
4
AA seq 358 aa AA seqDB search
MSTLRNFGLGKTYLEERIQEESRFLVAAIEDEKGQPFDPYHQINNAVSNVICSVTFGNRF
DYHDSDFQKLLHLLDETGVFLRNIWSHLYNAFPSLMRRLPGPHQTYFKNWEQLKSFVRKI
IEKHKEDWNPLKTKDFIDAYLNEMAKENASSTFHMENLLQSTLDLFVAGTETTSATLHWA
VLYMAVYPEIQAKVQAEIDSVIGQSHLPAMADRDNMPYTNAVIHEIQRRSSIVVVNAPRL
TANDTQVAGFHLPKGILEIGXLTSILFDKNEWETPNVFNPNHFLKNGQFMKREAFVPFST
GKRACPGEQMAKMELFLVFTTLLQKFTFQAPKGVKLSLDSKTGHVLKPKPYQICAISR
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgtcaacgctaaggaactttggactgggcaaaacatatttggaggaacgaatacaagaa
gagagcaggttccttgtggctgccattgaagatgagaaagggcagccatttgacccctac
catcaaattaacaatgctgtttcaaatgtaatttgttctgtcacttttgggaaccgcttt
gattaccacgacagtgatttccagaagttgttgcatttgcttgatgaaacaggagttttc
ctgagaaacatttggagccatctgtacaatgcttttccatctctcatgaggcgattgcca
ggacctcatcaaacctattttaaaaactgggaacaattgaaatcctttgtgagaaaaata
attgaaaagcacaaagaagactggaatccacttaaaacaaaagatttcattgatgcttat
ctaaatgaaatggcaaaggagaatgcttcttccacttttcacatggaaaatctcctgcag
tcaacactagatttgtttgttgctggaacagaaacgacatctgcaactttgcactgggct
gtgctgtacatggctgtttatccggaaattcaggcaaaggttcaggcagaaatagactct
gtgattggccagtctcacctcccagcaatggccgatcgggataatatgccttacactaac
gcagttattcatgaaattcaaagaagaagtagtattgtcgttgtaaatgctcctcgactg
acagctaatgacacacaggtagctggatttcatctgcccaaagggatattggaaataggn
nntctgacatcaatcttgtttgacaaaaatgaatgggagaccccaaatgtatttaacccc
aaccatttcctgaagaatggtcaattcatgaagagggaagctttcgtaccattttctaca
ggaaagagagcctgtcctggagagcagatggctaaaatggaacttttccttgtcttcact
accctacttcagaagttcactttccaggctccaaagggtgtgaagctaagccttgactcc
aagacagggcatgtactgaaaccaaagccataccaaatatgtgccatctctcgttaa

DBGET integrated database retrieval system