KEGG   Anolis carolinensis (green anole): 100561798Help
Entry
100561798         CDS       T01608                                 

Definition
alpha-2B adrenergic receptor-like
Orthology
K04139  
adrenergic receptor alpha-2B
Organism
acs  Anolis carolinensis (green anole)
Pathway
Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:acs00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100561798
G protein-coupled receptors [BR:acs04030]
 Class A. Rhodopsin family
  Biogenic amine [Fig]
   Adrenaline [OT]
    100561798
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 439 aa AA seqDB search
MTLAVMGGHDGYNVQATAAIAAVTTFLILFTIFGNVLVIIAVLTSRSLKAPQNLFLVSLA
AADILVATLIIPFSLANELMGYWYFDKVWCKAYLALDVLFCTASIVHLCAISLDRYWSVS
QAIEYNSKRTPRRIKCTILVVWLLAALISLPPLVFNTNPSEAQEDAKRCELNEQPWYILS
SSTCSFFAPCLIMILVYVRIYFIAKRRSRKGAAPKKAKAGKKMGEEREPNGHQLRMGEER
EPNGHQLRMGEEREPNGHQLRMGEEREPNGHQLRMEREGEPNGHQVTIQEDDHPFVSQEE
KKTRSPSPSQSQLGKKPWPGMETLATAKGEVLLVRRVKTLSANPWKRKTHLNREKRFTFV
LAVVMGVFVVCWFPFFFLYSLRAVCSARRCPIPDVTFKFFFWIGYCNSSLNPVIYTIFNQ
DFRKAFRRILCRPWTQTAW
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atgaccctggccgtgatgggtggccacgacggctacaacgtccaagccacggccgccatc
gctgccgtcaccaccttcctcatcctcttcaccatcttcggcaacgtcctggtcatcatc
gccgtgctgaccagccgctccttgaaagctcctcagaacctcttcttggtctccttggcg
gccgcggacatcttggtggccacgctcatcatccccttctccttggccaacgagttgatg
ggctactggtacttcgacaaggtctggtgcaaggcctacctggcgctggacgtcctcttc
tgcacggcctccatcgtccacctctgcgccatcagcctggaccgttactggtccgtcagc
caagccatcgagtacaactccaagcggacgccacggaggatcaagtgcaccatcctcgtg
gtctggctcctggcggccttgatctccctcccgcccttggtcttcaacaccaaccccagc
gaggcccaggaggacgccaagcgctgcgagctcaacgaacagccctggtacatcctctcc
tccagcacctgctccttcttcgcgccctgcctcatcatgatcctggtctacgtccggatc
tacttcatcgccaagcgacggagccggaaaggggccgcaccgaagaaggccaaggcgggg
aaaaagatgggagaagaacgagaacccaatgggcatcagttgaggatgggagaagaacga
gaacccaatgggcatcagttgaggatgggagaagaacgagaacccaatgggcatcagttg
aggatgggagaagaacgagaacccaatgggcatcagttgaggatggaaagggaaggagaa
cccaacgggcaccaggtgaccatccaagaagatgaccatccctttgtgagccaggaagag
aagaagaccagatcacccagtccttcccagtctcagttggggaagaaaccctggccgggc
atggagaccttggccacggccaagggcgaggtgctgctggtgcggagggtgaagaccctg
agcgccaacccttggaagcggaagacccacctgaaccgggagaagcgcttcaccttcgtc
ttggcggtggtgatgggggtctttgtggtctgctggttccccttcttcttcctctacagc
ctgcgggccgtgtgctcggccaggcgctgccccatcccggacgtcaccttcaagttcttc
ttctggatcggctactgcaacagctccttgaacccggtcatctacaccatcttcaaccag
gacttccgcaaggccttccggaggatcctctgccgcccgtggacccagacggcctggtga

  All links  
No link information was found.   
DBGET integrated database retrieval system