KEGG   Anolis carolinensis (green anole): 100561831Help
Entry
100561831         CDS       T01608                                 

Gene name
uchl1
Definition
ubiquitin carboxyl-terminal esterase L1 (ubiquitin thiolesterase)
Orthology
K05611  
ubiquitin carboxyl-terminal hydrolase L1 [EC:3.4.19.12]
Organism
acs  Anolis carolinensis (green anole)
Brite
Enzymes [BR:acs01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100561831 (uchl1)
Peptidases [BR:acs01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   100561831 (uchl1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
5
AA seq 224 aa AA seqDB search
MAWQPMEINPEMLNKVLSRLGIAPGWRFVDVLGFEEDSLNAVPNPACALLLLFPLTAQHE
NFRKQQVEELKGQEVSSKVYFLKQTASNSCGTIGLIHAIANNQDKILFDEGSALKEFLNA
TADLSPDERAKRLENNKAIQDAHNAVAEEGQCRAEDDKVNFHFILFASVDGQLYELDGRM
PFPINHGASSDDTLLKASAKVCRQFTEREQGEVRFSAVALSKSA
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atggcgtggcaaccgatggagatcaatcctgagatgctgaacaaagtgctgtcccgccta
ggaatcgcccctggctggcggtttgtggatgtgctggggtttgaggaggattccttaaat
gcagtacccaatccagcttgtgcactgctactgctctttccccttactgctcagcatgaa
aacttcagaaaacagcaggttgaagagctaaagggtcaagaagtaagctcaaaagtctat
tttctgaagcagactgccagtaattcatgtggaactattggccttattcatgcaattgct
aataaccaagataaaatactgtttgatgaggggtctgcactgaaagagttccttaatgcc
actgctgacctttctccagatgagagggcaaaacgtcttgaaaacaataaggcaattcaa
gatgcccataatgcagtagcggaagaaggccagtgtcgggctgaagatgataaagtgaac
tttcacttcattctgtttgccagtgtggatgggcaactatacgagttagatggccgaatg
cccttccctataaaccatggcgctagttcagatgacaccttgctgaaggcttctgccaag
gtctgccggcagttcacagaacgtgagcaaggagaggtccgcttttctgctgtggccctg
tctaagtctgcctga

DBGET integrated database retrieval system