KEGG   Anolis carolinensis (green anole): 100561853Help
Entry
100561853         CDS       T01608                                 

Gene name
st3gal5
Definition
ST3 beta-galactoside alpha-2,3-sialyltransferase 5
Orthology
K03370  
lactosylceramide alpha-2,3-sialyltransferase (sialyltransferase 9) [EC:2.4.99.9]
Organism
acs  Anolis carolinensis (green anole)
Pathway
Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways
Module
Glycosphingolipid biosynthesis, ganglio series, LacCer => GT3
Brite
KEGG Orthology (KO) [BR:acs00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00604 Glycosphingolipid biosynthesis - ganglio series
    100561853 (st3gal5)
Enzymes [BR:acs01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.9  lactosylceramide alpha-2,3-sialyltransferase
     100561853 (st3gal5)
Glycosyltransferases [BR:acs01003]
 Terminal extension
  Sialyltransferase
   100561853 (st3gal5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 370 aa AA seqDB search
MKMKRPSGFLKGTFKHVVVMVIGLCFIYIIKLSFDSEDCDMTRIHYVKTAHVKKTQKFAE
KVLQAPCRPSFVKKEMSRLFGEKYNINTSSFIRKDINAHEDIFKYEPPFGFHKFSEKLKD
LLELLPEYDLPEGLQSKHCKHCVVVGNGGVLHGLELGYVLNQFDIVIRLNSAPVQGYTDD
VGNKTTIRMTYPEGAPLSQHEYYPDSLFVAVLFKSVDFGWIQAVVKNETLPLWMRLFFWK
QVAEKIPVMPKQFRILNPAIIKETALDILEYPEPRPKFWGWDKNIPTIGVTAIVLATHLC
DEVSLAGFGYDLSQPNTPLHYYDNLCMAAMNEQTMHNVTTETKFLQKLIKEGVVKDLSGG
IFCTYCKKSS
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgaagatgaaaaggccaagtggttttttaaaaggtactttcaagcatgtcgtggtaatg
gtaattggtctttgtttcatttacatcatcaagttaagctttgattcagaggactgtgac
atgacaaggattcattacgtgaagacagcacatgtgaagaaaacacagaagttcgctgag
aaagttctacaagccccgtgtcgaccatcttttgtgaagaaagaaatgagcaggttattt
ggagagaagtacaatatcaatacatcttcttttataagaaaagatataaatgcacatgaa
gatatcttcaaatatgagccaccctttggatttcacaagttttcagaaaaactcaaagac
cttttggaacttttgcctgagtacgatttaccagaaggcttgcagtcaaagcactgtaag
cattgtgttgttgttgggaatggtggagtgcttcatggactggaactgggatatgtcttg
aatcagtttgatattgttataagattaaatagtgcaccagttcagggatatacagatgat
gttggtaataaaaccactataagaatgacctatccagaaggtgctcccttatctcaacat
gaatattatccagacagtttgtttgttgcagttctatttaaaagtgttgattttggctgg
attcaagcagtggttaaaaatgaaacgttgccactgtggatgcgactattcttttggaag
caggtggctgagaaaatacctgtgatgcctaaacagtttcgcatcttgaatccagcaatc
attaaagagactgctttggatattctggaatacccggaacctcggccaaagttttgggga
tgggataagaacatacccactattggagtgacggcaattgtcctggctacgcatttatgt
gatgaagtgagtttagctggatttggatacgatcttagtcaacccaacacaccattgcat
tattatgataatctttgcatggctgcaatgaatgaacagacaatgcacaatgtgactaca
gaaacaaaatttcttcagaagctgatcaaagagggagttgtaaaagatctcagtggagga
atattttgcacctattgcaagaagtcaagctaa

DBGET integrated database retrieval system