KEGG   Anolis carolinensis (green anole): 100561907Help
Entry
100561907         CDS       T01608                                 

Gene name
mapk8
Definition
mitogen-activated protein kinase 8
Orthology
K04440  
c-Jun N-terminal kinase [EC:2.7.11.24]
Organism
acs  Anolis carolinensis (green anole)
Pathway
MAPK signaling pathway
ErbB signaling pathway
FoxO signaling pathway
Protein processing in endoplasmic reticulum
Wnt signaling pathway
Focal adhesion
Toll-like receptor signaling pathway
NOD-like receptor signaling pathway
RIG-I-like receptor signaling pathway
Insulin signaling pathway
GnRH signaling pathway
Progesterone-mediated oocyte maturation
Adipocytokine signaling pathway
Salmonella infection
Herpes simplex infection
Brite
KEGG Orthology (KO) [BR:acs00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100561907 (mapk8)
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100561907 (mapk8)
   04012 ErbB signaling pathway
    100561907 (mapk8)
   04310 Wnt signaling pathway
    100561907 (mapk8)
   04068 FoxO signaling pathway
    100561907 (mapk8)
 Cellular Processes
  Cellular commiunity
   04510 Focal adhesion
    100561907 (mapk8)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    100561907 (mapk8)
   04621 NOD-like receptor signaling pathway
    100561907 (mapk8)
   04622 RIG-I-like receptor signaling pathway
    100561907 (mapk8)
  Endocrine system
   04910 Insulin signaling pathway
    100561907 (mapk8)
   04920 Adipocytokine signaling pathway
    100561907 (mapk8)
   04912 GnRH signaling pathway
    100561907 (mapk8)
   04914 Progesterone-mediated oocyte maturation
    100561907 (mapk8)
 Human Diseases
  Infectious diseases
   05132 Salmonella infection
    100561907 (mapk8)
   05168 Herpes simplex infection
    100561907 (mapk8)
Enzymes [BR:acs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     100561907 (mapk8)
Protein kinases [BR:acs01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   100561907 (mapk8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 562 aa AA seqDB search
MHNNPVIPAMKAFDNTLTVFKQGFRWDASFRSNGIKLEAPSESALRGHGNPIGDRGHITL
PQPQRSLHSEQNRKRREGAPRTGSQGKAATRRCGTGDVTPPGHRERRMRKRPANQSRPET
PPRCPSRLCLSPCSAARGGGRGGGGGGGASQPGAGRHPPRVLSARFMSFKLRCSFNGIMS
RSKHENNFYSVEIGDSTFTVLKRYQNLKPIGSGAQGIVCAAYDAILERNVAIKKLSRPFQ
NQTHAKRAYRELVLMKCVNHKNIIGLLNVFTPQKLLEEFQDVYIVMELMDANLCQVIQME
LDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSFMM
TPYVVTRYYRAPEVILGMGYKENVDIWSVGCIMGEMIKGGVLFPGTDHIDQWNKVIEQLG
TPCPEFMKKLQPTVRTYVENRPKYAGYSFEKLFPDVLFPVDSEHNKFKASQARDLLSKML
VIDASKRISVDEALQHPYINVWYDPSEAEAPPPKIPDKQLDEREHTIEEWKELIYNEVIE
LEEKTKNGIIRGQPSPLAQVQQ
NT seq 1689 nt NT seq  +upstreamnt  +downstreamnt
atgcacaacaacccagtgattccggccatgaaagccttcgacaacacattaacagttttc
aagcagggtttcaggtgggatgcctccttcagatccaatgggataaagctcgaggcccct
tcagaaagcgcgctgcgtggccatggcaacccaataggcgaccgtggacacatcacactt
cctcagcctcaaaggagccttcactctgaacaaaaccggaaacggcgggaaggcgcgcca
agaacgggcagccaggggaaggccgccacgcgcaggtgcggcaccggtgacgtcactccg
cctggtcaccgcgagcggcggatgcggaagaggcccgccaaccagagcagaccggaaacg
ccgccgcggtgcccgtcccgcctatgcctcagtccctgctcagccgcccggggaggagga
agaggaggcggagggggaggaggagcgtcgcagcccggcgccggccgccacccgcctcgg
gtgctctctgccagattcatgtcttttaagttaaggtgttcatttaacggaatcatgagc
agaagcaaacatgaaaacaacttctacagtgtagagattggagattctaccttcactgta
ctcaaaagataccagaatttaaaacccattggctcaggtgctcagggcatagtatgtgca
gcctatgatgctatccttgaaagaaatgttgcaatcaaaaagctaagtaggccatttcag
aaccaaacccatgcaaaaagagcctacagagaacttgttctcatgaagtgtgtaaatcac
aaaaatattattggcctgttgaatgtcttcactccacagaagttgctagaagaatttcaa
gatgtttacatagtgatggagctcatggatgcaaatctctgccaggtgattcagatggag
cttgaccatgaacgcatgtcctatctcctctatcagatgttgtgtggtattaagcatctt
cactcagctggaattatacatagggatttgaaacctagcaatatagtagtaaaatctgac
tgcactttgaagattcttgactttggactggctagaacagcaggaaccagttttatgatg
acaccttatgtagtgactcgttactacagagcaccagaagtcatcttaggaatgggatac
aaagaaaatgttgatatttggtcagtggggtgcatcatgggagaaatgatcaaaggtggt
gtattatttcctggtacagaccatattgatcagtggaataaagttattgagcaactagga
accccatgccctgaattcatgaagaaactacaaccaaccgtaaggacctatgtggagaac
aggcctaaatatgctggctatagttttgagaagcttttcccagatgtcctctttccagtt
gactctgaacacaacaaatttaaggccagtcaggcaagagatttgttatccaaaatgctg
gtgattgatgcctcaaaaagaatctcagtagatgaagctctacaacacccttatatcaat
gtctggtatgacccttcagaagcagaagcgcctcctccaaagataccagacaagcagtta
gatgaaagagagcatacaatagaagaatggaaagaactgatttacaatgaagttatagag
ctggaggagaaaaccaagaatggaattatacgcggacagccatctcctttagcacaggtg
cagcaatga

DBGET integrated database retrieval system