KEGG   Anolis carolinensis (green anole): 100561907Help
Entry
100561907         CDS       T01608                                 

Gene name
mapk8
Definition
(RefSeq) mitogen-activated protein kinase 8
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs04010  MAPK signaling pathway
acs04012  ErbB signaling pathway
acs04068  FoxO signaling pathway
acs04137  Mitophagy - animal
acs04140  Autophagy - animal
acs04141  Protein processing in endoplasmic reticulum
acs04210  Apoptosis
acs04217  Necroptosis
acs04310  Wnt signaling pathway
acs04510  Focal adhesion
acs04530  Tight junction
acs04620  Toll-like receptor signaling pathway
acs04621  NOD-like receptor signaling pathway
acs04622  RIG-I-like receptor signaling pathway
acs04625  C-type lectin receptor signaling pathway
acs04910  Insulin signaling pathway
acs04912  GnRH signaling pathway
acs04914  Progesterone-mediated oocyte maturation
acs04920  Adipocytokine signaling pathway
acs04933  AGE-RAGE signaling pathway in diabetic complications
acs05132  Salmonella infection
acs05168  Herpes simplex infection
Module
acs_M00688  MAPK (JNK) signaling
Brite
KEGG Orthology (KO) [BR:acs00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100561907 (mapk8)
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100561907 (mapk8)
   04012 ErbB signaling pathway
    100561907 (mapk8)
   04310 Wnt signaling pathway
    100561907 (mapk8)
   04068 FoxO signaling pathway
    100561907 (mapk8)
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    100561907 (mapk8)
   04137 Mitophagy - animal
    100561907 (mapk8)
  Cell growth and death
   04210 Apoptosis
    100561907 (mapk8)
   04217 Necroptosis
    100561907 (mapk8)
  Cellular community - eukaryotes
   04510 Focal adhesion
    100561907 (mapk8)
   04530 Tight junction
    100561907 (mapk8)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    100561907 (mapk8)
   04621 NOD-like receptor signaling pathway
    100561907 (mapk8)
   04622 RIG-I-like receptor signaling pathway
    100561907 (mapk8)
   04625 C-type lectin receptor signaling pathway
    100561907 (mapk8)
  Endocrine system
   04910 Insulin signaling pathway
    100561907 (mapk8)
   04920 Adipocytokine signaling pathway
    100561907 (mapk8)
   04912 GnRH signaling pathway
    100561907 (mapk8)
   04914 Progesterone-mediated oocyte maturation
    100561907 (mapk8)
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    100561907 (mapk8)
  Infectious diseases
   05132 Salmonella infection
    100561907 (mapk8)
   05168 Herpes simplex infection
    100561907 (mapk8)
Enzymes [BR:acs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     100561907 (mapk8)
Protein kinases [BR:acs01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   100561907 (mapk8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo Kinase-like RIO1 APH FTA2
Motif
Other DBs
NCBI-GeneID: 100561907
NCBI-ProteinID: XP_003225439
Position
Un
AA seq 553 aa AA seqDB search
MKAFDNTLTVFKQGFRWDASFRSNGIKLEAPSESALRGHGNPIGDRGHITLPQPQRSLHS
EQNRKRREGAPRTGSQGKAATRRCGTGDVTPPGHRERRMRKRPANQSRPETPPRCPSRLC
LSPCSAARGGGRGGGGGGGASQPGAGRHPPRVLSARFMSFKLRCSFNGIMSRSKHENNFY
SVEIGDSTFTVLKRYQNLKPIGSGAQGIVCAAYDAILERNVAIKKLSRPFQNQTHAKRAY
RELVLMKCVNHKNIIGLLNVFTPQKLLEEFQDVYIVMELMDANLCQVIQMELDHERMSYL
LYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSFMMTPYVVTRYY
RAPEVILGMGYKENVDIWSVGCIMGEMIKGGVLFPGTDHIDQWNKVIEQLGTPCPEFMKK
LQPTVRTYVENRPKYAGYSFEKLFPDVLFPVDSEHNKFKASQARDLLSKMLVIDASKRIS
VDEALQHPYINVWYDPSEAEAPPPKIPDKQLDEREHTIEEWKELIYNEVIELEEKTKNGI
IRGQPSPLAQVQQ
NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt
atgaaagccttcgacaacacattaacagttttcaagcagggtttcaggtgggatgcctcc
ttcagatccaatgggataaagctcgaggccccttcagaaagcgcgctgcgtggccatggc
aacccaataggcgaccgtggacacatcacacttcctcagcctcaaaggagccttcactct
gaacaaaaccggaaacggcgggaaggcgcgccaagaacgggcagccaggggaaggccgcc
acgcgcaggtgcggcaccggtgacgtcactccgcctggtcaccgcgagcggcggatgcgg
aagaggcccgccaaccagagcagaccggaaacgccgccgcggtgcccgtcccgcctatgc
ctcagtccctgctcagccgcccggggaggaggaagaggaggcggagggggaggaggagcg
tcgcagcccggcgccggccgccacccgcctcgggtgctctctgccagattcatgtctttt
aagttaaggtgttcatttaacggaatcatgagcagaagcaaacatgaaaacaacttctac
agtgtagagattggagattctaccttcactgtactcaaaagataccagaatttaaaaccc
attggctcaggtgctcagggcatagtatgtgcagcctatgatgctatccttgaaagaaat
gttgcaatcaaaaagctaagtaggccatttcagaaccaaacccatgcaaaaagagcctac
agagaacttgttctcatgaagtgtgtaaatcacaaaaatattattggcctgttgaatgtc
ttcactccacagaagttgctagaagaatttcaagatgtttacatagtgatggagctcatg
gatgcaaatctctgccaggtgattcagatggagcttgaccatgaacgcatgtcctatctc
ctctatcagatgttgtgtggtattaagcatcttcactcagctggaattatacatagggat
ttgaaacctagcaatatagtagtaaaatctgactgcactttgaagattcttgactttgga
ctggctagaacagcaggaaccagttttatgatgacaccttatgtagtgactcgttactac
agagcaccagaagtcatcttaggaatgggatacaaagaaaatgttgatatttggtcagtg
gggtgcatcatgggagaaatgatcaaaggtggtgtattatttcctggtacagaccatatt
gatcagtggaataaagttattgagcaactaggaaccccatgccctgaattcatgaagaaa
ctacaaccaaccgtaaggacctatgtggagaacaggcctaaatatgctggctatagtttt
gagaagcttttcccagatgtcctctttccagttgactctgaacacaacaaatttaaggcc
agtcaggcaagagatttgttatccaaaatgctggtgattgatgcctcaaaaagaatctca
gtagatgaagctctacaacacccttatatcaatgtctggtatgacccttcagaagcagaa
gcgcctcctccaaagataccagacaagcagttagatgaaagagagcatacaatagaagaa
tggaaagaactgatttacaatgaagttatagagctggaggagaaaaccaagaatggaatt
atacgcggacagccatctcctttagcacaggtgcagcaatga

DBGET integrated database retrieval system