KEGG   Anolis carolinensis (green anole): 100561922Help
Entry
100561922         CDS       T01608                                 

Gene name
bcl2l1
Definition
BCL2-like 1
Orthology
K04570  
BCL2-like 1 (apoptosis regulator Bcl-X)
Organism
acs  Anolis carolinensis (green anole)
Pathway
Apoptosis
Jak-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:acs00001]
 Environmental Information Processing
  Signal transduction
   04630 Jak-STAT signaling pathway
    100561922 (bcl2l1)
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    100561922 (bcl2l1)
Protein phosphatases and associated proteins [BR:acs01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100561922 (bcl2l1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 229 aa AA seqDB search
MSSSNRALVVDFLSYKLSQRGHSWHEIEMESGEEAMEPANETGNTLNGSPSWHPSPSHVI
NGASEHPELLEEEEEENPRVDVSQTLREAGDEFELRYRRAFSDLTSQLHITLGTAYQSFE
QVVNELFHDGVNWGRIVAFFSFGGALCVESVDKEMQGLVVRIASWMTTYLTEHLDPWIQE
NGGWERFVDVYGNDAAAKSRKGQERFNKWLWTGATVAGVVLLGSLLSRK
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgtcgagcagtaaccgagcgctcgtggtggacttcctttcctacaagctgtcgcagcgg
ggccacagctggcatgagattgagatggagagcggggaggaagcgatggagccagcaaac
gagacggggaacaccctcaatgggagcccttcttggcatcccagccccagccatgtcatc
aatggggcctcagaacaccccgaactccttgaagaggaggaggaagaaaacccgagggtg
gatgtcagccagacacttagggaggctggcgatgagtttgaactaaggtaccggcgggct
tttagtgacctgacctcccagctccacatcaccttgggcacggcataccagagcttcgag
caggtggtgaatgaactcttccacgatggggtaaactgggggcggatagtggcattcttc
tcctttgggggagccctgtgcgtggagagcgttgacaaagagatgcaagggttggtggtg
aggattgccagctggatgaccacgtacctgactgaacacctggacccctggatccaagaa
aacggtggctgggagcgatttgtggacgtctacgggaacgatgcggccgccaaaagcagg
aagggccaggaacgcttcaacaagtggctctggacaggggccaccgtggccggtgtggtg
ctcctgggctccctcctgagccgcaagtag

DBGET integrated database retrieval system