KEGG   Anolis carolinensis (green anole): 100561926Help
Entry
100561926         CDS       T01608                                 

Definition
ectonucleoside triphosphate diphosphohydrolase 2-like
Orthology
K01509  
adenosinetriphosphatase [EC:3.6.1.3]
Organism
acs  Anolis carolinensis (green anole)
Pathway
Purine metabolism
Brite
KEGG Orthology (KO) [BR:acs00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    100561926
Enzymes [BR:acs01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.3  adenosinetriphosphatase
     100561926
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 481 aa AA seqDB search
WRCSGVLAACRLLLLCLPPARMLRRAPAQKYGIVLDAGSSHTALFVYQWPADKENETGIV
SQHSMCDVQGGGISSYADNPPAAGSSLKACLDQAKAAVPAERHAETPLHLGATAGMRLLN
LTDPGATQRVLEAVSSALRETPFDFRGARILSGEEEGLFGWVTANYLMENFVKYGWVGRW
VRPKRATAGALDLGGASTQITFETPDPAAPAVPLRLYGQRFRVFTHSFLCFGRDQVLKRL
LGHLLKASSFRLALSNPCWPRGFSRSFPMESVFGSPCTAPLRPPNYFPSALVNMSGSGNA
GQCREQAARLLASQDFAGTALPNVTGRFIAFSAFFYTVDFLQSVTKRRVASPKDLEDATE
EICNMTWAQLLHAEPRMERFLPDYCPMANFVSLLLTRGYGFDETTFLDIAFQKKAGETSI
GWALGFMLNLTNMIPAEEAGSWRATAPGPWVGLLLLLVAILLVAAAASACLLRGRTTPGA
L
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
tggcgctgctcgggtgtcctggccgcctgtcgcctgctcctcctctgcctgccccccgcc
aggatgctccgccgcgcccccgcacaaaagtacggcatcgtcctggacgcgggctcctcg
cacacggcactcttcgtctaccaatggccggccgacaaggagaacgagaccggcatcgtc
agccagcacagcatgtgcgacgtgcaaggcgggggcatctccagctacgcggacaacccc
ccggcggccggttcgagcctgaaggcctgcctggaccaagccaaggccgccgtcccagcc
gagaggcacgccgagaccccgctccacctgggcgccaccgccggcatgcgcctgctcaac
ctgacggaccccggggccacgcagcgtgtcttggaggcggtgtcgtccgccctgcgcgag
accccctttgacttccgtggggcccggatcctgagcggggaggaggaaggcctcttcggc
tgggtcaccgccaactacctgatggagaacttcgtcaagtacggctgggtgggccggtgg
gtgcggccgaagcgggccacggcgggggcgctggacctgggcggggcctccacgcagatc
accttcgagacgccggacccggccgcccccgcggtgcccctccgcctctacggccagcgc
ttccgcgtcttcacccacagcttcctctgctttggccgcgaccaggtcctcaagaggctc
ctcggccacctcctcaaggcgtcctccttccgcctggcgctgtccaacccctgctggccg
aggggcttctcccgcagcttccccatggagtcggtcttcggctccccctgcacggccccc
ctgcggccccccaactacttcccctccgccctcgtcaacatgagcgggtcgggcaacgcc
gggcagtgccgggaacaggccgcgcggctcttggcctcccaggacttcgcggggaccgcc
ctgcccaacgtcaccgggagattcatcgctttctcggccttcttctacacggtggacttt
ctccagtcggtgaccaagaggcgcgtggcctccccgaaggacctggaagacgccaccgag
gagatctgcaacatgacctgggcccagctgctccacgcagagcctcgtatggagcgcttc
ctgccagactactgccccatggccaacttcgtctcccttctcctgacccgcggatatggc
ttcgacgagaccaccttcctggacatcgccttccagaaaaaggcgggggagacgtccatc
ggctgggccttgggcttcatgctgaacctgaccaacatgatcccggccgaggaggccggc
tcctggcgggccacggcgcccgggccttgggtgggcctcctcctcctcctcgtggccatc
ctcctcgtggccgccgccgcctccgcctgcctcctgcgcggccgcaccacccccggagcc
ctctag

DBGET integrated database retrieval system