KEGG   Anolis carolinensis (green anole): 100562059Help
Entry
100562059         CDS       T01608                                 

Definition
protein disulfide-isomerase A2-like
Orthology
K09581  
protein disulfide isomerase family A, member 2 [EC:5.3.4.1]
Organism
acs  Anolis carolinensis (green anole)
Brite
Enzymes [BR:acs01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     100562059
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 552 aa AA seqDB search
MGHFPGWMTLMLIPWLTLSWVRVAVTQETLTPTEGQQGPSEGRTLSGEPDLKVEEEEEVL
VLNQQGFTQALQENRLLLVLFHAPWSDLCQALAPEYAKAAALLREERSSSSLRLASVDGT
QEPELRQEFGVAGFPAFKLFREGDRSHPIDYKGEREAEAIVAWMRRKAKPSAPLLTGEEE
ATAFLATHPVAAVGFFHDPEGQEARLFCKVACDMDDDTVAVALTDRPALFDKYGVLGETV
ALFRWTDTEGSDAPRVDFLIDEELGLDEAELAHFLAVQSLEPVVEFTNQNSSRIFGAKVP
NHLVLFLNKTEGPHSALLEGFRGAAPTFRNQVLFVLANVGGDGASLLHFFGLKSHQVPAL
RFIHIETNQKYLLDMEQGRDLSASDISTFCQDVLEGRVQPHFMSEEPPSDWDQRPVKTLV
GQTFEQVALDESKDVFVRFYAPWCPHSKAMAPAWEQLGQRFDGRQDVLIAEMDATANEVP
GLPIRAFPTLYFFPAGKGKEMTEYRGDRDLDSLLRFLENGGETPPVEKPPETPKEEPKEE
GQAKSPEPRDEL
NT seq 1659 nt NT seq  +upstreamnt  +downstreamnt
atgggccacttccctggatggatgactctgatgctgatcccatggctgaccctgtcttgg
gtgcgagtagcagtcactcaggagacgctgacccccacagaggggcagcaagggcccagc
gaagggagaaccctctctggagaacctgacctcaaggtggaggaggaggaagaggtcttg
gtcctcaaccagcagggctttacacaggccttgcaggagaaccggctgctcctggtgctt
ttccatgccccctggagcgacctctgccaggcactggcccccgaatatgccaaggcggcc
gccttgctgagagaggagaggtccagcagctccctgaggctggcgtcggtggatgggacg
caggagccagagctgcggcaggagtttggcgttgctgggttccctgccttcaagctcttc
cgggagggagaccgcagccaccccatagactacaaaggggagagggaggccgaggcgatt
gtggcctggatgaggcggaaggccaaacccagcgccccgctgctcaccggggaggaggag
gccacagccttcctggccacccatccggtggctgctgttggattctttcacgacccagag
ggccaggaagctcgcctcttctgtaaggtggcctgcgatatggatgacgacactgtggcc
gtggccctcactgaccgcccggccctctttgacaagtacggcgtcctgggggagacagta
gccctcttccggtggacggacacggagggcagcgatgcccccagagtggacttcctcatt
gatgaggagctgggcttggatgaggcagagttggcccacttccttgcggtgcagagcctg
gagccggtggtggagttcacgaaccagaactcctccaggatatttggggccaaagtccca
aaccacctggtactcttcctcaacaagacggaggggccccattcggcacttctggaaggc
ttccggggagcggctcccaccttccggaaccaggtgctctttgtgttggccaacgttggt
ggggacggggccagcctgctccacttcttcggcctgaagagtcatcaggtccctgccctt
cggttcattcacattgagaccaaccagaagtatctcctggacatggagcaagggcgggac
ctctccgctagtgacatcagcaccttctgccaggatgtgctagaaggcagagtccagccc
cactttatgagcgaggagcccccaagcgactgggatcaacggccagtgaagaccttggtg
gggcagacctttgagcaggtggccctggacgagagcaaggatgtcttcgtcaggttctac
gccccctggtgcccccactccaaggccatggcgcctgcctgggagcagctgggccagagg
ttcgacggtcggcaggacgtcctcattgcggagatggacgccacagccaacgaggtgcca
gggctgcccatccgcgccttcccaacactctacttcttccctgctggaaaaggaaaggag
atgacagaataccggggtgacagagacctggacagcctcttgaggttcctggaaaatggg
ggagagacccctcctgtagagaagcccccagagacccccaaagaggagccgaaggaggag
ggccaggcgaagtctccggagccaagagatgagctgtaa

DBGET integrated database retrieval system